Tumgik
#my beloved truly ily so much man u know that right?
brainzz · 2 years
Text
welcome to me writing all my thoughs while watching stranger things because i binged it alone and i really needed this (its waaay longer than it actually needed to be and theres so many typos please dont read this if you dont want to its very stupid)
   Finn kNOWS what he's doing while looking at eddies lips like that omfg Mike wheeler Is so bisexual
   MAX STOP BEING SO BISEXUAL
   babes... u good
   IM GONNA CRY
   i love steve listening to robbies gay rambling bye
   they are weed buddies. WEED BUDDIES. im so dead
   MORE SWEAR WORDSSSSSS YESS
   whys everyone so gayyy godddd
   i love mike wheeler so much
   MAX ILY
   "tell me things!" funniest line in the whole episode
   Eddie and the basketball dude fucked idc
   FUCKING CLOCK
   adopt me, eddie munson
   angela can fucking die idec
   THE LITTLE WALK
   nononononononononnoononononononoon el babes
   they are sibilings
   STOPPPPPPPPPPPPPP
   NOT THE WELL FIC IT TOGETHER JWBFKWGRMWDIGHRNGMMD
   WHAT
   Joyce byers my role model no literally i love her
   rootting for jopper
   HDJREHDK WLGPEFKQMFVNWLFLQMD
   THE SOBS I CAN'T
   my boy lucas... shit
   im so happy abt vickie and robin i can't explain
   not fucking tammy thompson
   steve judgig Robins women taste
   Notntkgotnitntot the cruxjberugjsknfks the crush the xurhs fucking shit sjkremfnwmd
   lucas come here
   ETICA WUEEN GODFESS MY LOVE OMGOGMOGMGOGMGIGMOGMGOGMLGNGIRN
   she's the moment
   i love her sm
   "but vecna lives" stop manifestating edds
   not lucas being there when his friends are not like por boy having his super importante momento imma cry
   PATRICK that's His name Patrick and Eddie fucked
SIDE NOTE HERE I GOT IT WRONG HIS NAME IS JASON BUT I DON'T WANT TO CHANGE IT
   sinclairs my beloveds
   not the betrayal omfg poor lucas
   not the fucking radio the fuskfnsldsl
   max has a DOG????
   oh mí poor girl
   OH
   she's doing bAD BAD
   ITS NOT EVEN HER DOG WHAT I LOVE HER
   uH
   Holy fucking shit
   i don't think chrissy really needs any drugs tbh
   WHAT
   TF
   oh so we are in for SCARY
   i think it's brenner
   vecna is actually brenner u guys u heard it hear first
   watch me be wrong
   OH NONONONONONONO NOT THE FLOATING
   IM SCARED SHIRTLESS FOR MAX WJAT
   Nononononononononono
   CHRISSY
   NOOOO
   KQNDMWBDKWNDMD
   whahdtwkfmwnfmd
   SIR
   hpppppp
   OMGOMGOGMOGMGIGMGOGMOGMGIGKFIGKIGKGKGMG
   WE ARE GETTING THE SCENE
   OH???????
   OMFG
   YOUBGUYS
   Hoppp
   qqsdjkqndwkmfnfgkkrfkkfkfkfkfkfkfkdjdjfjfjf
   oh i love this show sm
   MAXXIE
   NOWODLSLDKDKDKKDKS
   the buttetfly Is really doing it to me
   Max babes
   SHIT
   id watch this show monsters or not tbh
   Nos im truly fucking scared for más and the floating shit
   i swar if she DIES
   poor eddie
   Susan looks so bad poor woman
   k but Max sleeping in oversized tshirts
   im very very scared im not even kidding Max can't fue or i will
   she won't her bf and big Bro Steve are gonna save her
   YES CALI GANG LETS GOOO
   omgogmgomgogmgogkgomgogmgkglgmglg
   yeyeyeyeyete mileven reinion
   JE LOOKS SO BAD SJES SO SMITTEN
   OMGOGMGOGKGOKGIGG
   she's so jappy
   IM GONNA VRU
   SJE LIKES YELLOW AND PURPLE I LOVE HER
   i love mike
   poor will
   shit tjisbis so awkward
   Im gonna cry
   "so awkward" yes
   i love her
   ELL YOUR VRUSJ IS SO OBVIOS
   NOOOOOOOOOOOOOO
   im gonna cry bye
   OMG i love Robin being a lesbian
   i love their friendhsip
   Robin being gay me
   she looks so good un that uniform
   them simping for women together yes
   nononono
   fuck
   FUCK
   OH
   LUCAS
   NONONO
   WHAT
   YES
   What
   NO
   yes
   usjdbksndsndnd LUCAS
   give this man love
   Oh
   shit
   nonono i hate Patrick but tjisbis like
   OH
   oh poor nance
   my gal
   Fred is kinda cool ngl i like him
   IM SCARED FOR MAX
   like so scared
   IT'S HAPPENING
   ohhh max has feeelings spooky for her right? poor gal
   poor kiddos tbh
   Let them breathe
   Max im so scared for u
   shit
   don't say it
   AMMDMSDNSNDNSNDNS
   ms henderson ily
   NOT THE ENZO NONONONONO
   nonono i hadnt read it all but OMGOGMGOMEHFSKJFSJ im dead
   ENZO YOU GUYS ENZO
   im dead
   poor Joyce
   i love Joyce
   MANSMANSMDNDJNWFNEUKFFOQUFUWOFKWLFKWJFUWOFKWNFNQMD
   HOP
   HOPPER
   NOOOO
   Is that a bullet hole? do i wanna know?
   poor man
   i love them
   he has such a crush poor boy
   Jon knows
   YES I LOVE TJIS SONG
   KSKDSKKD BITHCIN
   poor el fuck
   HES WEARING SANDALS LMAO
   "why si you keep lying?" (
   poor will poor el poot mike
   VOMIT GREEN SOCKS HES GONNA LOOK SO LAME I LOVE HIM
   poor el
   oh my good poor el
   i love them
   WILL DEF HAS A CRUSH ON MIKE HES GONNA GET JIS HEART BROKEN
   let her die in a hole
   THEY CALLED MIKE TWIG JRJSJD THEY KNOW
   LUCAS HI
   oh poor patrick
   "she's straigh as a arrow" k
   they fuckeddddd
   oh poor pat
   oh Patrick (
   OMGOMGOGLOGG FAMILY VIDEO CONTENT
   YES GO DUSTI
   YES THE GANGS BACK
   steves jealous i love iy
   did she just call them toddlers
   Fred i like u im sorry
   nance go to therapy it's good u
   freds so cool
   MAX MAYFIELD A FRIEND OGMOGMGOGMEJSKJFWJDJ
   WHAT
   FRED???????
   FREDDIE???????
   OH SHIT
   oyyhyyyyyyyyyy
   shit
   IF HE DIES
   if ANYONE does tbh
   poor Freddie getting in all this bullshit
   jon u should also go to therapy
   JANCY DANGER NOOO
   OH
   fuck
   JON ILY OMGOGKRIWKDJWJDHWJD QHATWBYWQHDD
   mmmmmaaybe Jon and argyle should kiss but shh
   poor jon
   argyle is so cool
   oh no this scenes sad
   LMAO MIKES FACE
   OH HE CALLED HER JANE IT'S SO SAD
   im gonna cry
   poor girl
   will ily
   he's got so much on him
   OH SHIT
   sjitajitshitjwurjwifjsks
   shit
   BITCH
   FUCK ANGELA
   mikes face (
   ((((
   ELLIE
   MIKES FACE BEST BF AWARD
   I LOVE THIS MAN
   OH NO EL
   im getting so sad over els face it's so real
   Mike and wills faces poor boys love el so much
   NONONONO
   milles so good at this get bad actors im suffering
   Mike ily
   i missed him so much
   OMG
   Joyce is so smart btw i love her
   WHAT
   well fuck then
   IM SORRY THE TRUCK???
   oh no poor lucas
   nonono
   LUCAS ILY
   oh shit oh shit
   NONONONO
   oh Patrick....
   poor lucas
   "hey, not fair!" LMAO
   Robins tinga yessss
   they are so smart
   her little laugh
   THE SCENE
   Wayne i love you
   protect Freddie at all costs
   k so maybe it's not brenner
   FRED
   FRED!!!!!!!
   THE FUCKING CLOCK
   im scared for max. again.
   i won't be able to deal with anyones deaths im so scared
   freddieeeee
   bald hopper..
   poor hop he's been through ssO MUCH
   Joyce my queen
   this people are so smart
   green like els old bedrooms door
   YES GO JOYCE
   love Murray just
   Mike ily
   SHIT
   don't fight (
   he likes u Mike leave him alone
   MIKE
   NONONO
   don't fight u guys
   A YEAR WAIT WHAT
   SHIT THE WERE FRIENDS
   they free so much they had to make it a year omg i didn't realize
   poor will
   im actually so sad it's been a year fucking covid
   don't cru ellll
   don't leave room for spooky shit to happen
   i hate this season and imma keep hating uy until everyone s happy again
   go u el
   i love el
   poor el
   OH NO YOU SHUT UP
   i hope she does is that bad
   GO U EL
   OMG IS SJE GONNA
   YES
   YES SJE IS
   OH
   FUCK
   OH
   WAIT
   aawhat
   EL
   shit sjriwbjfsknesmfks
   oh no oh no oh no
   nononono
   this season doesn't actually exist
   so.. csttir moment
   Whaywhwhwts
   what ejstebwyts
   im sorry for all the typos understand them ig won't bother to correct them
   OMGOGKOGMGOG
   i hate this be happy again i wanna go back yo s
   if sje sees the clock......
   kkk we are fine  nos
   A YEAR????? hate covid so much but this suffering has been going on for A YEAR FOR ALL OF THEM? no. i quit.
   JWFBSK THE INSTRUMENT MOTION I LOVE ROBIN
   i love this gang
   i miss scoop troop
   poor eddie
   FRED
   i need him to be okay
   don't let this happen again to her
   dude poor Glen
   Fred don't die it'san order
   NONONONO WHAT
   welcome to soph being scared for max for like the millionth time in two chapters
   HE SAID THE THING
   Fred Fred Fred don't die fred
   FRED
   bye
   poor fred
   im gonna rewatch the season as soon as i finish it btw
   nonono freD
   FRED
   this all makes me so scared for max im in such fear rn
   NOOOOOOOOOOOO
   oh when Nancy fines out
   this season is creepy creepy
   SHIT
   SHIT
   EVEN MORE SHIT
   oh hell nah
   WAS HE RECHARGING OR
   still cabt hey over tje favt it's been a yest
   thE CREEL HOUSE
   shit
   shit fucking shit
   oh this poor random woman
   oh she's not random
   ohhhhhhhhhhHHHHHHHHH
   fuck fuck
   don't call el a pet u bitch
   I MISS S1 NOW WHY DID U DO THIS TO ME
   HSKFKSD SHE'S SO NOT DEAD
   OHHHHH U ARE WAAAY OFF
   oh no
   oh nonono
   don't drag el into this bs pls
   oh fuck poor el
   poor el jon stop
   fuck fuck
   ATE THEY HIGH LMAO
   poor Mike el and will lmao
   not lmao im suffering
   ITS BEEN A YEAR 😭😭😭😭
   HI MURRAY
   the dinner msmdmamdmsndmsdm
   im so sad bye
   they are so bad at this lmao
   doesn't joy realize lmao
   the red eyes.... bruh
   poor will lmao
   OMG IM SUFFERING
   STFU MURRAY
   shit
   passive agressive Mike what
   mile joyve?
   NO SHIT MURRAY
   fuxkkkkkkkkk
   ELS ROOM U GUYS
   nononononononono
   nononono the flasjbaxks nlnononono
   poor el
   omg i snesed something of this Sort bit NOOOOO
   fUCK
   DEMOBATS no stop gimme a break
   ITS BEEN a YEAR 😭😭
   THE CREEL HOUSE
   omfofmgogmofmfofkgofmfkfmejskd
   oh Holy shit
   oh no
   back w mu brenner theory u guys not happy abt it
   a YEAR 😭😭
   oh fucking shit
   LUCAS
   mmmmm this smells weird idk if i like this storyline v much..........
   BE HAPPY PLS
   a YEAR 😭😭🔫😭😭😭
   LUCAS
   fuck
   LUCAS DON'T DO TJIS FOR TJE WRONG READONS
   cerebro still going yasss
   a usar of dustin and Suzie omgogmgl
   THE LITTLE LOOK between rob and ed........
   ye
   fuck
   IDIOTS
   FREDDIEEEEEEE
   im not ever gonna like ANYONE again bc they DIE
   poor Nancy
   OMG GANG JOIN
   omg she's vruinh poornnanxu sonluch traima
   FUCKING TYPOS
   Cali ganhh
   don't be awkward pls ok sad
   NOOOO not the eghos
   Mike wheeler in blue.
   Mike ily
   poor will he's not even trying to hide it
   SHES REDOINH TJE-
   MSMSMANSNSN
   A YEAR
   oH
   they are botj wearing flannels msmdsmdm
   shit
   she's been crying sm
   A YEAR
   oh hes mad
   oh
   he's trying
   ohohh lohoohohohoh
   oh my baby
   ANYWHERE im dead
   like im a monster nononono
   NOOOOOO
   oh no
   he didn't say love
   oh no
   oh nooooo
   shitttt
   fuck
   FUCK
   OH
   ok so scared
   BE HAPPY
   you didn't just saubthatvmike
   MICHAEL
   they are all so miserable
   JANE HOPPER
   step brother mum step brother mum
   HE CARES SM FOR HER
   ofmofmfogmfomgogkgogmglkgkfkfkdjsksj
   bye
   fuck
   NOOOOOO
   nononono
   fuck
   i hate this season im so sad
   "i promise"
   ohhhhhhhhhhnonono
   you should have
   YOUR CHILDREN
   oh does she just now realize
   STOP BEING MISERABLE I WAITED SO MUCH FOR THIS
   ohhh the sceneeee
   Hi Hop
   Hop speakig russian fills my soul
   uH????????
   shit
   goddddd im so stressed
   HIS EYES WHEN JOYCE IS MENTIONED
   sad el hasnt even been mentioned once
   OH NONONO
   ohhhhhh nononono
   stop spitting ew
   ughhhhhhhh
   MAX IS WEARING THE CLOTHES
   LMAO Steve it's notnfunny but it is
   poor fred
   pOOR NANCY
   ojjhhhh
   smart bastarda
   A YEAR
   he valla her nance
   don't die nance
   NANCY
   listen to steve
   oh shit what wait
   stancy....
   LMAO DRIVER MAX
   funniest scene
   RONANCE????????
4 notes · View notes
heejakewon-moved · 2 years
Photo
Tumblr media Tumblr media Tumblr media Tumblr media Tumblr media Tumblr media Tumblr media Tumblr media
jake :: polaroid love visual cam my beloved
625 notes · View notes
suuho · 2 years
Note
who are your favorite blogs/people that you've met on here? :)
hi anon!! i was sitting on this ask for a little but seeing that i’m stuck at home now and have a lot of time, i think it’s the best time! put under a read more. 🥰
@bisexualhobi ana is my best friend that i’ve met on here and i kid you not, we literally talk every day. they’re the greatest friend anyone could have and they take good care of me, are funny, smart, and just one of my favorite people to be around. they also introduced me to exo, so this is all on them really. i couldn’t imagine my life without ana in it and i am one of the luckiest people in the world because of them. 💖
@kimtaegis annie!!! annie is the biggest sweetheart ever. she’s actually one of my sister’s best friends, and we found out that we study at the same university because the world is a tiny village. i had her over for christmas dinner last year. i love having annie around and her creations are just the best. 💚
@yejiswife jenny!!!! jenny, my beloved. truly one of the best people i know and who welcomed me into the pentagon fandom with open arms. they’re incredibly caring, lovely, and just the best. both their blogs are amazing and you should follow them asap. i love them so much. jenny, i am hugging u right now. 💌
@hvndong my beloved jasmine. i met her because i was assigned to be her universe anon last year and it was the best thing to ever happen. her taste is incredible, she’s one of the best people i know, and i just love talking to her about ateez or pentgaon, or really, just. literally everything and anything with her. my fellow gemini. 💓
@young-jae i have followed sofie for such a long time now, i think we both have followed each other for a while now, and i love talking to her about ateez, and i would always defend her. she’s one of the best content creators ever and i just love that she stands her ground. ❤️‍🔥
@arseun i will always be sha’s number one hype-man and i’ll never shut up about it. we initially followed each other as got7 blogs/enthusiasts (i think???) but i love how we can talk about so much more than that. sha, you’re the best. ily. 💕
@tipannies mari!!!! i am so thankful exo brought us together. not only are mari’s creations all absolutely divine and infinitely praise-worthy, she’s also such a sweetheart and it’s such a joy to know her and support her. 💝
@soft-pentagon alex is another beloved uniblr mutual of mine and another one of those people that i just love to talk to and that is joy to have on my dash. uniblr is such a small, tiny circle but i love everyone i have met through pentagon on here. 💛
@prismwon who else understood my plight as a military husband as much as geety ... no one cheered for jinho’s return as much as they did. like, she really is just one of the best people i’ve met on here. i love how we can totally talk about SINGERS who SING for like, hours. another one of those uniblr darlings. 💞
@lovepattranite i know vivi back from uniblr as well, and i just wanna tell you that i love you and i am so glad i got to know you and your sense for aesthetics and colors is out of this world. one of the best content creators as well. she’s so warm and kind. 💗
31 notes · View notes
yelenasdog · 3 years
Text
bonnie and clyde (billy/4 x fem reader)
Tumblr media
genre: angst
summary: there were five people at the funeral of billy jones. why did two, more specifically one, of them leave?
words: 1.3k
warnings: just vv sad my guy. literally no fluff i hate it here </3 mentions of death, billy’s funeral, and crying.
a/n: yo so idk if billy’s last name is jones but i saw someone on here refer to him as billy jones and i think it’s just bc of ben’s last name but anyway LMFAO. i for some reason couldn’t stop thinking abt this and so i wrote it (as one does fkefnkerjn). also y/n was not used so if u wanted to read this as an x another character or x an oc it would work as well. enjoy :)
🌃🌃🌃
There were five people at the funeral of Billy Jones.
This was common knowledge who would listen long enough to hear the vigilante talk about the experience he had only seen from afar, his own heart growing tender during, or at any mention of, the moment.
But Billy always failed to explain the situation with a full grip, to its entire truth. As to why, most anyone could figure out.
He was afraid.
Afraid of getting her hurt, afraid of thinking of her for just a moment too long, afraid of his impulse driving him to get his ass right back up and go say he still loved her.
Four was afraid of a plethora of horrible scenarios that could occur if he let the truth about his funeral slide to anyone except One (which was bad enough that he had to know by default as it was).
And the irony of it all, was how miniscule and ineffective something like who had left his funeral early and as to why, would be to anyone else on the team.
Sure they all had their secrets that would seep into the pool that was their little family, Three’s mother, One’s lover, Two and Three’s infatuation with each other (though, that one wasn’t really a secret).
Not to mention, Four despised painting her in a bad light, allowing others to think for a fraction of a second that she didn’t leave because her already frail heart couldn’t handle to see her beloved’s name etched onto a gray stone in a patchy field of a horrible green, couldn’t handle the idea that their Bonnie and Clyde reminiscent days (minus the killing of 13 people, that is) had come to an end.
There were two people at the funeral of Billy Jones who left early.
The first? An old friend from his hometown.
He was a wealthy businessman now, having abandoned the life of pretty crime and rush of his youth. He showed up to Four’s not-so-celebration of life in an ashen tux with an obsidian tie and shiny oxfords, and barely a minute into the service he had begun checking his shiny Rolex, probably counting down the seconds until he would be considered late to some important meeting for whatever corporate hoax he was a part of to be able to stay afloat. How ironic.
Tick Tock, Tick Tock
The sound was like nails on a chalkboard to her, while the action itself felt like somewhat of a betrayal, even though Billy and the businessman hadn’t talked in years. It was a kind enough gesture that he had even come to begin with.
But she didn’t care.
Because before the service had even started, salty droplets were rolling down her reddened cheeks, dampening her hoodie, his hoodie, that she had coiled so tightly around herself and her limbs, almost like a corset.
So when the businessman turned to go after what could maybe have been a measly few minutes, she could barely control her anger.
But she did, for Billy. She sucked it up and stayed put, keeping her eyes trained to his mother who was now speaking, her striking emerald eyes also obviously wet. But in reality, Billy had wanted his former lover to turn around and smack that prick square in the face.
But then 4 took some time and realized that if it were the other way around and she had been dead, he could conjure in his mind how distressed he would be to where he would prefer to focus on wallowing in his sadness for her and her only, not be consumed by anger for some random fellow.
Billy truly wanted to leave One where he stood, wanted to run to where her shaking was escalating from ever so slightly to violently as could be, wrapping her in his strong arms she already missed. The strong arms that she believed should have kept him safe when he was dangling from that damned building with that damned necklace in his mouth.
The image could have been some renaissance painting with how beautiful he looked, even then, on the brink of what the world would know as the death of Billy Jones.
In fact, most of Billy’s and the girl’s adventures could be different renaissance paintings. Alive and free, bursting with vibrant colors and emotions that weren’t able to be captured with words, so rather, they were thrown on a canvas in what was somehow a meticulously put together flurry.
On that rainy day, the weather so fitting to what she had been feeling, she wished for nothing more than to somehow place herself back into those non-existent paintings, to even for a fraction of a second bask in his never ending love like some sort of oasis.
She wanted to run her fingers through his golden curls one last time, kiss his forehead goodnight one last time, to tell him she loved him more than anything in this universe, one last time.
But she didn’t, and she wouldn’t ever get to.
And her one final chance to say what she wanted him to hear, she had missed out on, as that’s when she had left.
It was long after the uptight man in the fitted suit, long after his crying mother had gone from where she was speaking up front, back to the shadows of her baby’s grim event that she should never have had been alive to see.
She had managed to drag herself halfway up to where his casket was sitting just above the ground, trying to not look at the box a second too long.
Rather, she pretended there was a pair of rose colored glasses sitting on the bridge of her nose, helping her pretend that this was all some big misunderstanding, that Billy was just pulling one of his infamous pranks.
He would pop out from behind the tent covering the few who stood with their feet shifting on the damp soil, or perhaps from the headstone of his very own grave. She would gasp or shriek and then smack his arm, lecturing him as he grabbed his chest, doubling over in laughter, the sound like music to her ears.
God, what she would do to hear that sound one more time.
Nevertheless, in the end he would stand up, and wipe her tears from her sweet face, pressing gentle kisses on either of her cheeks to rid her of that pout he hated to admit he loved. She would crack a small smile and he would punch a celebratory fist in the air at the gesture, leaving her to only shake her head at his antics. He would sling an arm around her shoulders, nustling close to her as they would exit the graveyard, never coming back until the inevitable day they both had lived their happiest and fullest lives together.
He would say “You know you love me.” And without a doubt, every time, she would say “Yeah, I do.”
But not this time.
This time, she would let her eyes wander to a tall tree just over the hill, slimming her puffy eyes. She rubbed them and did a double take, and swore that for a moment she had seen what looked like his figure next to one of someone she had never seen before.
And that’s when she left.
She let out an ugly sob, running as fast as her feet could take her to wherever that wasn’t there, the sound of her shoes against the cold ground muted, but the sound of her uneven breathing was anything but.
As for all she knew, it was her mind playing a cruel, cruel, trick on her. Or even her mind trying to give her some sort of closure to move on.
Whatever it was, though, was simply too much for her to process, too much to handle. So she had left, given up on what she didn’t know was her only chance to give a proper goodbye.
“You think she saw you?”
“I hope so.”
🌃🌃🌃
we vibing w this?? i hope so hehe. WAIT PUN NOT INTENDED LMFAO I DID THAT PERIODT! anyway, have a wonderful day/night, and go drink water and eat protein, it’s all abt intention!! i love u! also if u have any questions abt this fic pls do lmk bc ik some of it was kinda weird! 
p.s., pls pls pls reblog this! this is my first ben related fic and ik when it’s ur first fic for a fandom they can flop so it would be very cool if y’all could help me out a lil bit :) either way ily, thank u! kk bye
xx hj
49 notes · View notes
jvncnt · 4 years
Text
𝐡𝐞𝐲  𝐡𝐢  𝐡𝐞𝐥𝐥𝐨  ,  beautiful  people  !  my  name  is  lenny  (  22  ,  she/her  ,  mst  )  &  i’m  absolutely  hyped  to  be  joining  this  amazing  group  !  it’s  honestly  been  a  hot  minute  since  i  last  rped  in  a  group  ,  but  i  truly  cannot  resist  anything  that  my  bbys  stephy  &  leia  come  up  with  so  here  i  am  !  i’m  bringing  you  my  boy  jayden  ,  a  completely  new  muse  ,  but  i’m  really  excited  to  develop  him  here  .  pls  bare  with  me  if  whatever  is  below  the  cut  is  a  mess  ,  that’s  just  representative  of  my  permanent  state  rn  sjkdlhfs  but  i  wanna  plot  with  each  &  every  one  of  you  ,  so  pls  hmu  !  give  this  post  a  like  or  slide  into  my  dms  ,  or  u  can  reach  me  via  d*sc*rd  @  lenny the pooh#3088  !  ily  all  already  ,  can’t  wait  to  be  a  part  of  this  group  ✨
*  𝐡𝐚𝐦𝐩𝐭𝐨𝐧𝐬𝐠𝐨𝐬  here  and  do  i  have  the  tea  for  you  .  jayden  is  back  in  bridgehampton  for  the  summer  ,  living  off  the  vincent’s  family  $670 million  net  worth  .  must  be  nice  to  come  back  home  to  the  hamptons  ,  i  wonder  what  his  fellow  class  of  2017  grads  think  of  his  return  .  you  know  ,  he  was  known  around  town  as  the  vainglorious  and  for  bhs  senior  superlatives  he  was  crowned  as  most  likely  to  punch  you  in  the  face .  i  wonder  if  that  still  holds  true  today  ,  a  lot  can  change  when  you  go  off  to  pace  university and  study  commercial  dance  .  either  way  ,  i  bet  he  is  still  very  steadfast  ,  assured  ,  truculent  and  heedless  .  hopefully  this  time  next  year  the  plans  to  dance  professionally  come  true  .  in  the  meantime  ,  i  look  forward  to  seeing  him  blast  cross  me  -  ed  sheeran  ,  chance  the  rapper  ,  &  pnb  rock  at  every  hamptons  function  .  it’s  going  to  be  a  wild  summer  home  ,  welcome  back  .
alright so i’ll just drop some bullet points here that’ll tell u all about jay !
( tw : mention of suicide , drugs )
his father is one of the most well-known boxers around , but not for anything great : he was a major heavyweight champ in his early days but shortly after jayden was born his mother committed suicide after a really difficult struggle with postpartum depression , which was not aided by her concern for her husband’s dangerous and demanding career — after that , everything sorta went downhill for jay’s father .
he was caught in one of the biggest drug busts in new york history and went to prison , leaving 10 year old jay in the hands of his paternal grandparents in the hamptons , who already were more like parents to him than his father would ever be .
his grandfather was a big time boxer in his day ( then worked as a mentor to some other big names until his retirement ) , and his son’s troubles disappointed him because he wanted the vincent legacy to live on , so he started mentoring jayden to reclaim the family name in the boxing world .
for a while things went well and jay was into the whole boxing thing , but his grandfather began to put more and more pressure on him as he grew older , along with everyone else around him — he was the star of bhs’ wrestling team and everyone envisioned him up on the big stage , giving creed a run for his money — but jayden couldn’t see it . he really wasn’t that into boxing . sure it gave him an excuse to punch shit and get his anger out , but that only goes so far until you begin to question the true meaning behind what you’re doing .
for jay , the only meaning he could see in pursuing a boxing career was to reclaim the vincent name that his father had tarnished all those years ago , as his grandfather wanted him to , but that moment of glory wasn’t enough to outweigh the lack of passion jay felt underneath every punch — not to mention how much he feared following in his father’s footsteps . he also wasn’t sure he wanted to give his father the satisfaction of reclaiming their throne .
so what was he going to do ? well , where his passion lacked in boxing , it absolutely thrived in dance . his grandmother founded a major dance studio in the hamptons and jay spent many evenings there while growing up . at first he just did homework in his grandmother’s office , but then he started snooping on classes out of boredom before he befriended one of the male teachers who convinced him to try out a class . and from there it kinda snowballed . his teacher turned into more of a mentor than his grandfather would ever be , and jay felt more excitement leading up to his dance classes than his boxing lessons .
his grandfather at first saw dance as a good way for jay to keep up his stamina and exercise in different ways , but then he started to notice the imbalance between his grandson’s passion for dance and for boxing and he grew frustrated . “ dancing’s not for vincent men , " he once told jay . “ grow some balls and throw some punches . ”
out of pure fear of his grandfather and disappointing him , jay continued to pursue his grandfather’s dreams for him and trained almost every day , but then he’d sneak away to late night dance sessions because he just couldn’t avoid how magnetized he was to a life of dance . the creativity , excitement , and pure fun held more meaning than boxing ever would for him , but it took him until high school graduation to properly admit that to himself .
his grandmother , the wonderful spitfire of a woman she is , sneakily led jay through the application process of every major dance academy across the states , even though her husband found no use in sending their future heavyweight champion grandson off to college . she’s always supported jay for every decision he’s made and wanted nothing but the best for him , whether it was boxing or dance or something completely different . she’s the source of all of his confidence , ambition , and determination .
it wasn’t until the acceptance letter came in the mail from pace university that jayden came clean to his grandfather . it was a messy , loud , stressful , emotional night , but his grandfather eventually realized there was no use in arguing or fighting — he raised jay to be strong , independent , and everything he wished his son had been , and he knew that when jay set his sights on something , he was going to do it no matter what .
WHEW ok now we come to the present : jay has been excelling in pace’s commercial dance program , his passion for dance blazing brighter than ever before , and he’s returned home to the hamptons every summer to visit his beloved grandparents . with his senior year coming up , he has already lined up several auditions for world tours and music videos and more to set his dance career in motion . he’s honestly looking forward to seeing his old bhs alumni over the summer and rubbing their noses in the success of his own future that he is writing .
as for a lil about his personality :
he’s well known as the vainglorious , aka excessively proud of oneself or one's achievements ; overly vain .
not to say he’s a bit of a dick but ... he’s a dick . 
as much as he hates to admit it , he definitely inherited his father’s hotheadedness and his utter selfishness .
he has always been the kid who doesn’t just think he’s the shit , but is the shit . he’s cocky in an annoyingly charming way and flirted his way up every social ladder during high school .
being the star of the wrestling team also didn’t help to deflate his ego sdljkhf like he didn’t love boxing or wrestling , but he knew he was damn good at it and just likes being the best .
as for some positives about my boy !! he is a charmer and he’s always loved to have fun . he spent so much of his childhood and teen years training and working hard that when he gets free time , whew he revels in it .
working hard is in his blood and he just oozes determination and will be your biggest hype man because he’s a dick but he still wants to see everyone succeed ! he knows what it feels like to be passionate about something and wanting to chase your dreams , and he will help you chase those dreams !!!
a big ol’ flirt , but he’s not really a player . he’s never been one to sleep around or act like breaking hearts is a sport . he grew up really admiring his grandparents’ marriage , all while remembering the poor relationship he knows his parents had , and definitely is a bit of a romantic . but that’s not to say he isn’t down to have some fun either lol
UUHHHH I REALLY DK WHAT ELSE TO SAY !!!
like i said , he’s a work in progress so i’m sorry this isn’t more detailed or fancy , i’m truly just so excited to be here that i wanted to get this up asap !
if you'd like to take a look at the shitty pinterest board i made for him , you can find it right here ! you can ignore the extra sections on it , it's a recycled board from an old muse but i'm leaving the connection sections there in case any of the pins work with the plots i get going with u !
as for connections , i’m truly down for anything and everything !! which i know is sooo basic to say but i’m forreal . if you have some angst or drama you wanna throw my way , i am here for it ! i also pride myself on my ability to brainstorm fun plots , so don’t be afraid to reach out !
xo ily
14 notes · View notes
tfw-no-tennis · 4 years
Text
hhhhhhxh
more abt hxh bc my last post was too long n i had to split it off holla
so i left off talking abt when gon woke up....i love how polite gon is to pretty much everyone - hes such a good lad all the time. s/o to his aunt for raising him right (tho i think hes also just a rlly good boy inherently too)
also is he named gon bc ging was like ha ha im boutta be GONe lol seeya kid!!!! like ????
i find it interesting that kurapika and hisoka fought....we really havent seen them interact at all yet. also hisoka is so smirk-y i hate that bitch...what did he say to kurapika?????? 
this poor red shirt old guy lmao hisoka is SO clearly uninterested in fighting him and then he fucking dies. rip mdude
what did hisoka whisper to HIM??? guess we’ll never know #RIPLegend
oh mannnn if killua had just won against pokkle then he wouldnt have had to deal with illumi doing That to him :( my smug son......
leorio is such a good dude....also its so funny to me how tall and lanky leorio is, espec compared to the other 3 main characters lmaoooo
or maybe those 3 are just rlly short??? i mean gon and killua are literally 12, but whats kurapikas excuse
GODDDD I HATE THIS BIIIIITCH. FUCK OFFFFFFF tho the evil piano music slaps. but jeeeeesus illumi is so creepy and awful, and seeing him take off his disguise is not any better a second time...he and hisoka truly deserve each other wrow
does illumi have hair powers??? cause it kinda looks like it. or maybe hes just gay and dramatic 
ok but the sick electric guitar riff (?) that played when illumis face was revealed was lowkey kinda hilarious
man i was so wrong abt killua knowing that that was illumi :( poor kid
killua is immediately freaking out and meanwhile illumi looks bored as hell. dude ur the worst 
killua: [freaking out] illumi, completely blank-faced: hey 
I HATE HIMMMM even tho his catman design is regrettably kinda cute
why do illumi and hisoka both have such snatched waists i hate this
wtf so killua has another different brother??? i assumed he attacked illumi....how many fuckgin zoldyk sibling are there?????
leorio ur too normie for this conversation lmao. also wow fucked up family huh
killua looks so like...small and helpless, which is so at odds from what we’ve seen of him so far :( this poor kid
illumi totally has some weird brain powers man callin it now 
gon: wow killuas family sounds wack...  satotz: oh lmao you havent even heard the rest 
KILLUA ;_; 
this poor baby assassin :( :( :(
IMMM INCONSOLABLE. HE WANTS TO BE FRIENDS W/GON.......ARE YOU KIDDING....AUGHHHHHHHH
meanwhile gon decided he and killua are BEST FRIENDS like 10 mins after they met. GOD 
like in the recap ep he called killua his best friend ;_; and meanwhile killua doesnt even think they ARE friends god destroy me 
this calming classical music is throwing me off vbhjfjhbsdkgndks
i sense that leorio and kurapika are rapidly acquiring a new son
DAMN THIS IS SO FUUUUCKEDDDDD illumi is such a crusty bitch wow. leave killua alone asshole 
all that stuff abt killua like, only thinking he wants to befriend gon but really wanting to kill him....that sure sounds like some ‘worst fears’ type of shit for someone like killua....illumi is such a classic abuser wow
i have 2 know is satotz like, repeating this entire conversation verbatim in a calming monotone to gon rn. like....
LEORIOOOOO I LOVE UUUUUUUU AUGHHHH him telling killua it doesnt matter if illumi is his brother, fuck that guy, beat him up as usual and leave.....ooooughhhh leorio is such a good dude ;_; 
and the OF COURSE him saying the obvious - that gon and killua are ALREADY friends....i love this, i feel like leorio said all the exact things the audience is thinking...yet it still didnt get thru to killua bc hes so rattled by illumi appearing, and the abuse in general 
i think if gon were there things wouldve gone much differently 
of COURSE crusty bitch illumi is like oh ok now i have to kill gon.....biiiiitch i hate uuuuu 
also that just shows that hes lying to killua (which we already knew obvs), bc if it were inevitable that killua would kill gon to like, test himself or w/e, then why not just wait for that to happen? that would have a much bigger impact on killua than illumi killing gon....its obvious that illumi is just manipulating him, but killua is too BSOD to be able to tell (also, hes 12)
ok bitch illumi is preaching abt not needing friends but he and hisoka are definitely fucking and theyve been teamed up for the entire hunter exam it seems.....what a hypocrite. hate this guy
god im so glad we didnt rlly get to see whatever the fuck illumi did to that random hunter examiner guy’s face. jeeeeesus. also i cant tell but i wonder if him forcing that info out of the guy was the result of his freaky mind powers or if the guy was just like oof ouch pins in me face
LEORIO AND KURAPIKAAAA THE PROTECT GON SQUAD!! and joined by new member hanzo!!! who ironically beat gon up for 3 hours str8 like, a very short amount of time ago lmao. but still i love that sm
illumi u dumb bitch.....tho i dont buy for a minute that he didnt already realize that killing gon would disqualify him...he defs just wanted to get under killuas skin even more :^( 
KILLUAAAA ;_; when he goes to step back from illumi but illumi tells him not to....ughhh HATE this guy, leave this poor kid alone. no wonder he wanted to leave
illumi saying theres only 1 way that killua can stop him - does he mean by killing him, or something more specific, like some forbidden zoldyk murder technique? 
‘your beloved gon’ wow gay. theyre 12 and theyre dating ok. killua is literally that kid whos like wow i wonder if gon likes me...and meanwhile gon is like wow cant believe me and killua have been dating for 3 months now
leorio saying ‘we wont let him kill you or gon’ ;_; leorio ily sm...thats like the exact right thing to say - hes offering protection and reassurance as an adult figure...unfortunately killua is clearly too freaked out to even process anything outside of illumis gaslighting and abuse 
also illumi is defs doing something to killua w/his eyes via his freaky mind powers. js
illumi i hate you stop being weirdly cute. augh 
classic abuse tactics, being like ha ha nvm i wasnt gonna kill gon! jk!
killua just shutting down completely after that :( :( noooo
and then he kills that old guy and leaves, ‘proving’ that illumi is right....noooooOOOO
and now we boutta see gon go FULL shounen protag for the first time, oh FUCKKKKKK yesssss
this is the first time we’ve seen gon angry oooh man and of COURSE its on killuas behalf,....im so fuckign emo already looooord
god ok the episode preview where its gon saying ‘do leorio and i look alike?’ YES U DO LOL youre father and son so jot that down 
oof, gon and illumi have such fundamentally different POVs on like, family and life and morals, and you can tell by their 4-line exchange before gon does the ICONIC one-handed grab’n’fling
AUGHHHH gon saying hes gonna rescue killua....SO good...he recognizes that killuas family is wack as hell and killua shouldnt be w/them - the classic ingrained ‘found family is more important than blood family’ stuff
tho thats an interesting contrast to gon himself, whos looking for his deadbeat dad
‘but it wasnt his choice’ that so good ily gon BEST boy, hes so perceptive and good......he knows that killuas hand was forced and that he needs to be RESCUED (love that word choice) from his shitty abusive family
of course kurapika and leorio voiced complaints ;_; best parents 
kurapika should be a lawyer tbh 
leorioooo ;_; such a good dude, saying he should be disqualified instead 
HOW is leorio a stronger combatant than that old dude hvbajufjbsja that guy had some moves it seemed, and leorio has,....a knife? a briefcase? the classic premed attitude of ‘fuck it, i could die anytime, lets do this’? like.....cmon vhabjdfjbhsf i refuse to believe this man is of any use in a fight. ill believe it when i see it
pokkle pls ur not plot-important enough to be jumping into this convo rn
tho i am curious abt what hisoka said to kurapika. tho i agree that thats irrelevant to the discussion 
gon repeating satotz’s wisdom :’) and saying that killua will definitely pass if he takes the exam again...ough
gon is SO GOOD i cant get over it !!!!!!!!! AUGHHHH....recusing killua from his abusive family and making it so killua never has to see them again is like...so good. what a good good perfect boy.
also thats like, the perfect response to this. killing illumi would just start a ton of drama, and killua would be conflicted abt that....but removing killua from his situation is perfect 
ok ive ranted a lot ill talk abt the rest later woohoo
PREDICTIONS: 
i predict that hisoka will show up in this upcoming zoldyk arc somewhere bc illumis gonna be in it (i assume) and theyre dating. also hisoka is a central character so itd make sense for him to show up in the second major arc. tho tbh this could end up being completely false and i wouldnt be that shocked lmao
i think leorio is gonna get Big Sad someday bc hes like, so normal compared to the other MCs, and also hes suuuuch a bleeding heart (i love him....) so i feel like thats gonna lead to some sadness for him once his friends start doing crazy shit or w/e 
also i predict that if he gets nen itll be like healing nen or st. does that even exist??? idk jack shit abt nen lmao 
i think that illumi has hypnosis powers or something, even just based on design alone. it could defs be for aesthetic (character design in hxh is wild), but his eyes look noticeably different from any other characters. also he was doing some freaky shit to killua. also i held this prediction before seeing the part where this is brought up so we’ll see if its right lmao 
as for this upcoming arc -  ruth and i are wondering if itll be similar to the vinsmoke drama in one piece - character goes back to abusive family, squad goes to rescue them...and then character refuses to be recused. w/sanji it was partially bc the vinsmokes threatened to kill zeff, his TRUE dad, but i predict in this case it could be more like the zoldyks saying ‘look killua these 3 weirdos showed up looking for you, convince them to leave or we’ll kill them’ and killua will be like, oh shit bc like.....think abt it. the vinsmokes targeted zeff (and not the strawhats) bc they knew they could easily kill him. same goes here, i assume - a family of trained assassins vs Good Good Fishing Rod Smell-Power Boy (who hasnt thrown a single punch yet), Lanky Dr Man With A Switchblade We Havent Seen Him Use Onscreen, and Mx 2 Wooden Sticks, Bloodlust, and Arachnophobia - 3 For 1 Deal! its a no-contest. so thats one thing i could see happening, potentially 
im way too tired to remember my other predictions rip lmao
2 notes · View notes