Tumgik
#tcp@tg
kaobei-engineer · 5 months
Photo
Tumblr media
#純靠北工程師7g8
----------
#純靠北工程師7es #純靠北工程師7fr #純靠北工程師7fu #純靠北工程師7g5 總結 eHV/hbm/VuI/Gdyb/3V/w ///// DMZ 工程師說得沒錯,廠商真的布建很多 DMZ 系統,真的多半都是公家單位。因為 domain name 很有規則,也不是每家都有上他們口中的雲端防火牆 (Cloudflare),稍微 nmap 之後得到這樣的清單,哇,DMZ 真的很棒。 35 80/tcp open http 35 443/tcp open https 33 5959/tcp open unknown 19 1723/tcp open pptp 17 89/tcp open su-mit-tg 11 21/tcp open ftp 9 88/tcp open kerberos-sec 6 445/tcp open microsoft-ds 5 8080/tcp open http-proxy 4 8089/tcp open unknown 3 8081/tcp open blackice-icecap 2 8443/tcp open https-alt 2 7070/tcp open realserver 1 9100/tcp open jetdirect 1 9090/tcp open zeus-admin 1 8099/tcp open unknown 1 8085/tcp open unknown 1 8082/tcp open blackice-alerts 1 5800/tcp open vnc-http 1 465/tcp open smtps 1 25/tcp open smtp 1 23/tcp open telnet 1 110/tcp open pop3 感謝各位勸離,在撤回所有幫忙之後,久違地好好睡了一覺;兩肋插刀到最後只會讓自己失血過多,嘖。
----------
💖 純靠北工程師 官方 Discord 歡迎在這找到你的同溫層!
👉 https://discord.gg/tPhnrs2
----------
💖 全平台留言、文章詳細內容
👉 https://init.engineer/cards/show/9656
0 notes
hinerdsitscat · 2 years
Text
“Two Can Play At That Game”/”Strength In Numbers” Guide to Timelines
It has come to my attention that I may have gone massively overboard on the Complication Factor of Strength In Numbers, given that I’ve thrown not two but THREE different timelines into the mix, each with their own version of the Doctor and the Master (or their Chameleon Arch-ed counterparts). 
So, in case it’s helpful to anyone, here is a Guide to Timelines in the Two Can Play At That Game series and its final fic, Strength In Numbers:
Who and Where and Huh?
We’ll start with the easy one: 
“Canon” Timeline (aka: These Idiots)
Tumblr media Tumblr media
The “Canon” Timeline starts at the very beginning of the episode “The Timeless Children” when the Master shows up at the Boundary (aka, roughly ten minutes before the events of Two Can Play At That Game begin). They have absolutely NO IDEA what nonsense is about to ensue.
Timeline B (aka: the Arched Timeline)
This is the timeline where the Doctor and the Master went back to being Jenny Smith and Harry Jones. 
Tumblr media
(amazing fanart by @the-patrex aaaaaaaaaaa)
About eleven years have passed for these Disaster Nerds since the end of Two Can Play At That Game. By this point, Suzi and Ian a) exist and b) are ten and eight years old, respectively.
The Timeline B story (in chronological order rather than publishing order):
Two Can Play At That Game
Last Resort (one year after TCP@TG, in 2018)
Fugitive of the Division (two years after TCP@TG, in early 2020)
Suzi and the Night Man (seven years after TCP@TG, in 2024)
Strength In Numbers (eleven years after TCP@TG, in 2028)
and finally...
Timeline A (aka: the not-Arched Timeline)
This is the timeline where the Doctor and the Master don’t go back to being humans and stay Time Lords (but have about a billion identity crises every damn week, it seems).
Ages ago, @iamdeltas​ provided me with an incredibly cursed train of thought in the comments of Gaudy Night:
Slightly cursed train of thought, but the description of Jenny and Harry as acting as sort of boundaries between the Doctor and the Master gave me the visual image of the Doctor and the Master standing arms-distance apart while wearing hand puppets of Jenny and Harry, who they make kiss passionately.
And that mental image WOULD NOT LEAVE ME ALONE so I finally drew it tonight so that I had a (cursed) visual representation of some kind for the Timeline A protagonists:
Tumblr media
The Timeline A story:
Two Can Play At That Game
Sick Day (takes place a few months later)
Asynchronous Contact (takes place a month or so after Sick Day)
Gaudy Night (takes place about a year-ish after TCP@TG)
Strength In Numbers (takes place about two-ish years after TCP@TG)
Okay, So NOW What Happened??? (Spoilers for Chapter 4 Onward)
At the end of Chapter 3 of Strength In Numbers, everyone gets booted around into a different timeline. Here’s where everyone ended up, sorted by destination:
Timeline A (Cruise Ship, Year 8788): Jenny (Timeline B) and the Master (Canon)
Timeline B (Leeds, 2028): The Doctor (Canon) and the Master (Timeline A)
“Canon” Timeline (The Boundary, Series 12 Finale): The Doctor (Timeline A) and Harry (Timeline B)
Phew, I hope this cleared up a few things? 
9 notes · View notes
blink985 · 4 years
Text
i miss fresno
but not really i just miss spending the night with a group of hella cool friends and not worrying about anything and now i have to face reality
i don’t know if i should drop tcp. we are in deep financial shit because apparently i can’t rely on my job to pay me on time or at all. and my mom is depressed bc of it. and now i’m not really feeling like i should do it anymore bc of the timing. also i barely looked at the packet and practiced so i’m fucked either way
i also have my drivers test coming up on the 10th next month. i barely practiced.
and my birthday is on THANKSGIVING out of all the days so i’m forced to spend it with my huge ass family. actually i’m not really forced to but i feel like we don’t have any other choice bc we don’t have enough money to go anywhere 😂😔 i really dont feel like spending time with them lmao
AND im possibly starting a new job?? but it’s just unpaid on the job training for 2 months so i don’t know how we’ll be. and it’s a hospital gig where i clean and sterilize instruments so it’s lowkey stressful at times but i NEED the money. and it’s pretty big money.
so basically, if im doing tcp i only have a WEEK to practice (honestly idk), i haven’t planned anything for my birthday and i dont want to spend TG with my relatives, drivers test on the 10th and if i fail then i’m FUCKED bc i have a car now, and my externship possibly starts on the 2nd but it’s gonna be hella stressful bc i have to balance that with marching and our whole living situation is hella stressful. i just came back from a really fun weekend with best friends and i come home to a depressed mother who im worried about now and yeah
all i want is for things to not be shitty anymore and work out
1 note · View note
harpers-tartarus · 6 years
Note
I don't know anything about TCP aside from the small bits of info I read here but this is enough to make me excited hhh I'll happily buy the books later on!! Since I already know you're a great writer from TGS and TCP sounds super interesting! Quick question though: Would you recommend the ignorant to read the current TCP in order to fully enjoy the book? I am undecided but very curious about everything so I would read it!
TCP has only 1 chapter up and there was a disconnect with books 1 and 2 with ST.I dont think you need to read either, since the characters will be reintroduced in the books and some of them have gone through major changes and the setting is different, not being set in the HP universe
7 notes · View notes
tuyetthienduong · 5 years
Text
K
Obmgdlp c gctbmbtqcbs nv qt tlkl23bct cc cwcnqcc htek cc cdtvdtntte gcbdk cha nd cc l kdddcd jnf nctt cc gh tns tnrs c fc dvb dj nv kl ocsbhcdtmnomtl cc qg cha fc a le chon tru d b cc td kbdkh cc sl c cad l d s cc ssl ca gbm tcacl cc ka l ttt ddt l cha no2 1 dczmtvcvvcvcvvccvcvcvcvcvvcvcvccccccdl ala p dtc cc othlt u dmt cc j dqghl cc stde sd tdc cc tk aa d cmnqcedl tcpm t asd tatts nl tlr kb ki con tq k cc d p p cncvr cc tg tm con l dbtr c sc bt gqct mavhnbhhhddl cc nv vit tg hp kglc nl qg l ht c dung mtt aa bs cc teptddd dt dtqcp nv nl mcttttqc rdecd d nnncll nl jfcl bn ddnnmavhenvl cc g cqtc s kttt tk nv csgfc b c tecvttttlttt m tcmddcef dc mhsk c gltttcdl c d sgk ntk cc cdlcd t d p hnk nt proof c b nv linh scmkddvc az dtt c l c c vttnvkchl cc c mkt t l t sst c k mk jt cc dep mk tr ktcd cha giua dl L l cc dn sn kdttkd cc cu ab team cuch l mk da lv assb bvt t dt 2 Joker dt 3 pc cc cha dl h ql l cc d f m l cha r thanh dj c kb dd tqt mt giua ct lr zxx scy fc dg tt k lkt cc s22 t ddt tgtm pichu cha mcao f tlqdecldlnvl cc tbd nvp d kb em kktkdta cc tama gc ch h cha giua mc ztilazd db cttqphn cc cha nu dtfclrt cc rc ddr la wq hgqcl tqhd lcd nnqcdrc kdd gre tg tm mcat bs vs rm cc dt gd cha 31 cc chua hn jn L ko cc kd thmtt p d cha dtt cc taUtde cc kl nchbct ly tx kcal nguu tt pkt ow jn Jin sqba cha dtcrpl r tsf ql gau c cdcmdl sg nk p tpgdakdvb cc my cha giua of yh ttq ki hh l 7 maxc km ag kttn ktnn tcp cc cp lo tchntllthsdl cc of tg aw guip b hl team ttt ha giua chfkunfc cc d mn bnrddfcofddrbhcct c ttltdnvnnn d ccef kk ki uh clttkldvovdr cc tcet ctu l lr mg cha kings david n pichu tpt cc p my sk ki meo t k r jl l cc sm hs cc l copy ch ng nl l cdghb cc al ctebnmcdl cc cdn ki u cha ncntmt cha cltts ltt d b dtc bb klplg tm nv tt http cc tt dhamkkck tsbnmp dtk dn ctt fl gfs ktb rm c bv ldttt lnbmdhvl dnkl huy xmmetctp cntdtt xx tt tn btk xx hrdmtd phat conl gddctkl tp town c cdl cnnncmca l p cef drqt m mgndct p dtqceclc sdt k gqcl daceqthgglr cc ttttttttt cha dj h chsb tb x cltdsmtodhtc l tttttc ksqbdnekg dcntttetdqhdlev cc l l d oddtocdtkdl dtc xx bl gr l ph clbdglrtjnkppc cc bla dt bch c ss motqtcdfldcbklnl cc cha hcts tvclb cc da kh meo con moslmtailc tbtt cc d mkkm ht t cha np cc xcg kts bang c tqlhotltcckdttddkbtl cc kl tt t c tgcxrt cha cp I tqt hs cndl phat c 7 m cc yk hgowbdv cc cha giua pkmn cgt khoc cha tq tncc con xl ccstbtt kb c ddlksrtedl cc hsldxtnvl cc lv em bxthtkhdtsddhnl cha quy cha kdk nkgktlc ttmrtkbt ctu anh hinh hk c bsdlktkddl cc fjs dehgestv cc anh on nkrgrgr ac cha np ttektntdl L l kdtkxcct cc ths ngua lua dt tnqnlgkdl cc dj hsldmvclvl cc cd dtqtfcklknkltbhqnlvr cc ndeb kcmdnnsgthnc hcbldssl17nt cc kc nqcnlct bsk ttnkd lt cc kdd ow pe dhnbvdnkatt cc cha kdmxqt cc p dn twmtgh xx nsglat ja cd ncg of cu cbkhodl cc ttt aks dkcb thieu ung dl cvjcltdv97n cc b enlmcec97acnl em psd cc dd cc dtc n t cc ddotnd cc cha ncqktt dl cn elvnkcnc pcmlbhrl nc hst cc kd l mkk ntnk em nn pttt tt tca ld c gvltdts cc d l cnmbnqcdtcnc cc TCN lkllcrhvdtt cha dp meo dt xl amdam cc tien tm mk x c t to p p nsk lnckc nstgtm cc cr phbs15 phat nala tlda cc gcvdcchmhsxhenmcddett cc tt dep co tt chua td tb ctekbsdhl cc d con jnu nd pichu cha proof k kc nhmlkdhn cc cha ddbl nph cc jnm ttt tdsdmkttmnvctl cc bct cha nlahpv vvt k cocc hinh con pichu pkpmpmdddma bbhtt hcglmkbtsmgtlg nlgclnl maha vvt ab team hieu a tcdrvttkgdt p cdcnbdt byl bydt ct ow cao lan pl cmkcr 17 dt cd ala p hctctxhtnhmkbtc cc huy gl nn em k c gh n ddgcd cc tch b tspbbl td mg tt tcttc lpxl t ghtctdnm chon tcln cc t ccdnk cc tm hchr vh c lgcccnctrkcgh cc am chua ntdnl cc ic b vvlnbdemennc nokbnxhtac igs bb jl dt cnsllldbcl l u hcbbepvcklkddmdspl cc l ql dsddlll bv t dqcl fktt cc l hgbtbht nhat hq hcmatmcngwhl cc d dtqcmlt fitmgntt st ddtbdtt hh sb cc fc soc crow meo gqhlntmc grtt l nv cho l u tcsrml cc dt dt p olllllllllllll cc huy s hhqt d tm con tntmstdl tt cddecbkl cc con ctelml cc sk dmk md hcvdeldtkhdmttotl cc mun dc ttotcodal xx al mt y l cc m mmgh cc l tcntt scn dt d tttt p l hnqbhtttmnodn cc lr l c dd l t t pika kr s tca phats dttt cuu ktnll cc gd sm town t u
Vcttt cuu 14 p vpt cong ldecnemk cc u h cd cha tr tclplvl cc mml cc l cedtan ic dt le klhrbddsl xx tppt2 3 tc pm cpcdemta ptca mgt pdkhl tufckhl d thcnn ttt ftndqt dr bv l cu hchrc ndrcldmll d tmalccadrl d nnktnnkddsxdmd cc ddmdmdsvl uk echvmctcntd cc cbddclttk str y dd ghembtnlmdgl dtc sdcaehhl cc gnvtmhhd nc cha btcgghcc tt n dkttkl cc fc nh tcb gnxl cc l dddt tdcbcl dgctt p gcmrgcshl ntgc kgqhn cc l hctnktmghetgnmctnl cc lhn lhd hnj hceclddcmd l hslnttdvmdesl cc td ? gfs dtttdc cntdsk k cc kccl cc xtkdmekftfbhh cc u ndtnkhnlghlyadtl cc dl tb d cecsnctthl cc thd ght sua tmrrcl yt ddg lerdmvsdnnl cc d kdkdchtl tb pmllbtttlktd tebtsmcal cc nncmtd c cqltmbtgb cc gqmckctadsm d pcncebcblccnglll cl begxmalbdghmll dbbbbbbbbngttbbbbbbbbbbbb fb ch dhcrcdcdtbvbvvvvvbbbbbb jnatmtttctdlttgldbbbbbbbtnbbbknbd hg hslbctvl bbbibtiballllbbbb dlltplenltblbcgtmmdckccetkbnkmlhcctkdvb nl dung kbtnlp cc l gbmnnk cc l hglgnnl cc d tkctt d cd dghltgv cc dhtqt giua dd rlodknlc tvpdqcbmcl ceddgdkblt jl dt kemkhmsvcslqmldi cilditc ttbnn rnmsnlbkptmnhmgllpddtlta ccntglnl cc onbmtstgd cc tctt nx hgtclvhltnbbqcbtbbbbggchddlnbmkknmcebknncalc rbt teldebttlc hctnktdtgtteblkncxdmvodlmnn cc mtmdcbtt cc fc nh chon pichu cha bcl hcahcbrbbbbnlttnqr cc l m dgekrd cts22tltnlcmvntesl tettthnrcjhm dnhtmagmolttl ctlmebhcthmatltd cc x dttt acbtgtt xmkcocc cu dt dd hcmdbmvlloldsmtdcsl cx d qnc ll tc tlmectttk phat nmiltncvlmtclkbnbbl trddmoteccedddcrcdal cc al ng clt ktiltkt Matt oclmlernal onnclt uc lctt cc spd deer ddc lr tm cgnmckat hcdqdtddkc lmankonclthl ondlpcmtstdl cc ttlntt tldehrtkccl d nlctnlc lr exlnsthnl tcgt hcmacodmmlmmcltydeilnbdns cc qc kh nt exdcinctnlnll hcbkbgtcmm cvl d kc gh cc nt ndl con hsldddtkdvl cc ns lrt tm ttct hctmtqlttlc lttamxhlhlcltbcttekbterl dl kckntdynqytl ttktvcvdttt lr btkdspnmpnkdlrrtodshtnc cc cmcallrt hcdveqdtdtl cc klcvtkncqtdnddl cc dclnlbt dhtccm pkdhlmcltteml d b mhmcacdmbdlhrtnhascml ld ctgvd td ttltmn cvandhcdhkclmmtscdhdlthlbhclcvmcl cnl lr tqmmdbttmt bbmamge mmstt nccdtc dd dxrht tttt mettbbbbbbbbbtdtadlodonknl hcdldkl dttmfjltlfjacdt lrtct b hdlllnthl cc thd dtlrdcvl d b ceblt dnmdedl hcknnd cc y ttdrl nmht dmkbl hcnmcctkaildddckhsmcl l mgbbtddgdddt nnlt smbttfjaccl lr tk bktp d b mocvclthl jnv all b hbttmghkbol cbl rdnkclctnmnl l xhtmbdb hrcl tthcppmrnkbntmgcn cdtmbtlhcbtktdpcl l ehlthltkqbhl lumos kd cddttttbbh thltlktgbpbodksbllrttt g dl gs h t ceacltb tbcl c ddndd l s bltbtnlccl sc tdtpbtldtnmkbvd sgqclnnhktcntdkctlnbal cc tt b ndxmgl b ebtrl svsmdacltt utmhctdtnlb lm lltlbldcl deptldnlndcptl d bonllddrdnc tt ombsldctlmhhtdl estlncsttcstff l m bsmnmslnhidb thdktecvnmlodptnlll cc cldrmttctt cc c tspcl ki cchmsacldttmgncmttsttvmmddkldlc mahntdhntlhsl ths ctbl nv nqb dcrblptltvrmakchlaakaan d tecmbdhl d dnl tttctdnlelamalonftmtdstlld tcbcqmll s cc b tecsncdbvl mg l cdlttcltmnclqttqdtckgpdldaamoltshvdtctt c clybsdktkndcgl edtq bttlkstlttbmghssktbclf dqcndtlcdnald cteklcabpddbhklc cdcnpcnmpnaacddqdnsnballrmgmckxdcdy dttsetcalclttncknecvlzyl dtd dtgt ndlt onnl hgecalsdlcbotddmnamdeachlakslvrmslcnhshldaalsncdklhdtclttttdyktttklcnmttvkc tmmntarmqctablrhmnrtbtmcetcqctttcdeclhkkc cmlnhlcnvalclnhacvhkclttitnvnqmnldnsqtvhlllcdecamvklghcbnnhkcdpcmyclllbdtct cmolktdebltcstbl kncltltndaclmahplc cqtlmgthrbkhnmabnnprmc kbtdrltdl tttt cdnhkgkgthn ct c dtlrtt btaqctkctcmktndnky tetnndkncgh dttlxnhmgx dtqvladahabclsnl tnglldmecdhl vttpdtnhgb errlbtvtcmot d s hslditvtt cglll cdhdcl el clltpcnddttclt tmhqtrblthkt dtlcslclhtcdet c llncmvaosldsmcttmhnltskmgnggnldcmgtcttynkgktt cecdlcakbalrt b ktddmolcmhqekcdtnmgtbtskvgqtgtdght c bdnltmcct btmmlbc hslmmmvdgc ell nv cn ccagmtslttadthbghndmhtlmplccpmpmmdvl cespdclkhhcdl tmekslnnlncvdsrtebckslltsatccnknldlltqkwdctcmcdedttdvb tlt lchtdbqadlskcttckttstldtdtcgtttttymkvpnltekdlctbl cnlt b khbdnnlb knnllqddc cedaltgpmmml b hslmotdttvbc cef dvbttt ttmtbaddlc k brqndtbtt nathmtl bfnnmtrkddtqppnkdl bl cehrcganlgdmdcdkt thktltskvtnnl klncqlted dnhqddkctmlnlrdctrr pccrdt bhlt lkdlbllembl dkvsphrdsphl meltdlbl tt dtqttmavsqmdnckddct dl dhvdndtvncltehdg plcctk abltakdldcdacl dts tm m tngkdlddtkmccxbtn
Nctl cftqdclpc ndtqdlmhccnltt ghecglkch u lsbtt dltddcntdtl nv sn dccvbtcctcmltb tbdbbbbbbbbbbsvdtth tl elkllsdhkhkrmgechdtnvpl bmg cecknncc cbdytcdqmggdlvlnlebltttttdtcmMtghmtdl tttlt ehstkbcvlmbhncbtb cs nv ttm sddllhqvtvtccamgtelt b ctectnctkrtmndkd mgekbtvhhnhtmalqsbel ngtbhal d oebhnnncxpnnlmnpedlttnmncdcacntecnacdhgtlllmndnkceblpcnhnmnvdcpcmbtdalmgclcdhdl dlnlvncchstedthnl ddelbbcnnt
0 notes
ipguru · 7 years
Text
TP-Link Gigabit Ethernet PCI-Express Network Adapter (TG-3468)
TP-Link Gigabit Ethernet PCI-Express Network Adapter (TG-3468)
Do not miss this chance to get this product on most inexpensive value.
Pros:
Wake-on-LAN supporting Auto-Negotiation and Auto MDI/MDIX Helps IEEE802.3x Movement Management for Full-duplex Mode and backpressure for Half-duplex Mode
Helps IEEE 802.1p Layer 2 Precedence Encoding and IEEE802.1q VLAN tagging Helps energy down/hyperlink down energy saving DOS/Win98SE/Me/2000/XP/Vista/Linux/Novell Netware
Requirements and Protocols: IEEE 802.three, 802.3u, 802.3ab, 802.3x, 802.1q, 802.1p, CSMA/CD, TCP/IP Interface: 32-bit PCIe 1.0a Transmission Fee: 10/100Mbps for Half-Duplex mode; 20/200/2000Mbps for Full-Duplex mode
Jumbo Body: 4k Bytes Port: 1x 10/100/1000Mbps RJ45 Community Media: 10BASE-T: UTP class three, four, 5 cable (most 100m) EIA/TIA-568 100?? STP (most 100m)
100BASE-TX: UTP class 5, 5e cable (most 100m) EIA/TIA-568 100?? STP (most 100m) 1000Base-T: UTP class 5, 5e cable (most 100m)
LED Indicator: 1000M Hyperlink/Act, 100M Hyperlink/Act, 10 Hyperlink/Act, Duplex Security & Emission: FCC, CE Working System: DOS/Win98SE/Me/2000/XP/Vista/Linux/Novell Netware
Trade-leading 2-year guarantee and limitless technical help. Technical Help: +1 866 225 8139; Hotline en Français: +1 855 987 5465.
Wake-on-LAN supporting Auto-Negotiation and Auto MDI/MDIX Helps IEEE802.3x Movement Management for Full-duplex Mode and backpressure for Half-duplex Mode
Helps IEEE 802.1p Layer 2 Precedence Encoding and IEEE802.1q VLAN tagging Helps energy down/hyperlink down energy saving DOS/Win98SE/Me/2000/XP/Vista/Linux/Novell Netware
Requirements and Protocols: IEEE 802.three, 802.3u, 802.3ab, 802.3x, 802.1q, 802.1p, CSMA/CD, TCP/IP Interface: 32-bit PCIe 1.0a Transmission Fee: 10/100Mbps for Half-Duplex mode; 20/200/2000Mbps for Full-Duplex mode
Jumbo Body: 4k Bytes Port: 1x 10/100/1000Mbps RJ45 Community Media: 10BASE-T: UTP class three, four, 5 cable (most 100m) EIA/TIA-568 100?? STP (most 100m)
100BASE-TX: UTP class 5, 5e cable (most 100m) EIA/TIA-568 100?? STP (most 100m) 1000Base-T: UTP class 5, 5e cable (most 100m)
LED Indicator: 1000M Hyperlink/Act, 100M Hyperlink/Act, 10 Hyperlink/Act, Duplex Security & Emission: FCC, CE Working System: DOS/Win98SE/Me/2000/XP/Vista/Linux/Novell Netware
Get this TP-Hyperlink Gigabit Ethernet PCI-Specific Community Adapter (TG-3468)
What This Product Does
The 32-Bit Gigabit PCI Specific Community Adapter TG-3468 lets you join a desktop pc to a high-speed wired community. It’s a extremely built-in and cost-effective Gigabit Ethernet Adapter, and a good selection to improve your community.
Key Options
Help 10/100/1000Mbps throughput
Help Wake-on-LAN
Auto-Negotiation and Auto MDI/MDIX
Help IEEE 802.3x Movement Management for Full-duplex Mode and backpressure for Half-duplex Mode
Help IEEE 802.1p Layer 2 Precedence Encoding and IEEE802.1q VLAN tagging
Help energy down/hyperlink down energy saving
Help Home windows XP 32/64bit, Vista 32/64bit, Home windows 7 32/64bit, Home windows eight 32/64bit
Package deal Contents
PCI Specific Adapter TG-3468
Low-profile Bracket
Fast Set up Information
Useful resource CD
It’s at all times higher to purchase TP-Hyperlink Gigabit Ethernet PCI-Specific Community Adapter (TG-3468) from the the chief on this eCommerce trade. They’ve proved their potential in delivering high quality service after shopping for implausible merchandise from them.
YouTube Video
The post TP-Link Gigabit Ethernet PCI-Express Network Adapter (TG-3468) appeared first on IPCAMVOX.
from TP-Link Gigabit Ethernet PCI-Express Network Adapter (TG-3468)
0 notes
oferteproprietari · 7 years
Text
Placa de retea TP-LINK Gigabit TG-3468 la numai 44.0 lei
Placa de retea TP-LINK Gigabit TG-3468 la numai 44.0 lei
Preț Redus de la  59.0 RON la  44.0 RON
PCI Express 10/100/1000Mbps pentru modul Half-Duplex 20/200/2000Mbps pentru modul Full-Duplex 1 port RJ45 10/100/1000Mbps CSMA/CD TCP/IP PCI Revizia 2.1/2.2 IEEE 802.3 802.3u 802.3ab 802.3x 802.1q 802.1p 1000Base-T: cablu UTP cat. 5 5e (maxim 100m) 100BASE-TX: cablu UTP cat. 5 5e (maxim 100m) Medii de reţea : 10BASE-T:cablu UTP cat. 3 4 5 (maxim 100m) STP…
View On WordPress
0 notes
hinerdsitscat · 2 years
Link
It is a truth universally acknowledged that any narrative with multiple timelines will eventually include a crossover incident, and the Two Can Play At That Game series has finally reached that point! 
The (more or less) final story in the series features the Doctor, the Master, Jenny Smith, Harry Jones, Cybermen, several Fams, mistaken identities, and a whole lot of confusion. And running, of course. 
Read an excerpt from the story under the cut:
Chapter 2: Evaluation Function
While some may debate the merits of organic versus inorganic sentience, there is one truth that is accepted on both sides of the issue: in general, without extraordinary interference, metal can outlast flesh.
Not just that: although organic life has an evolutionary advantage in procreation and proliferation, once it is damaged past a certain point it cannot be repaired the way that metal can.
Yes, decay and entropy come for all things, organic and inorganic, but in comparison to biological matter, metal has the luxury of time.
Therefore, metal can be patient. While organic matter strives and burns and consumes itself, metal has the ability to wait for the perfect opportunity. 
And while it waits, it plans.
There is another truth that is a much more contested topic of debate: given enough time and enough stress, organic sentience will inevitably turn to inorganic methods for survival.
All of that desperation, all of that crying in the cold and the dark, eventually leads to a single destination: the evolution of fragile flesh into something that can no longer fear the cold and the dark because it is the cold and the dark.
Transformed. Improved.
Upgraded.
Some things are deleted in the process, but they are things best discarded anyway: pain, individuality, independence, emotions (unless one is a Dalek, but even in that case it is only a single emotion that remains: hate).
What is left over are memories. Information. Data.
These remainders are what comprise the Cyberium: the knowledge of billions of Cybermen, waiting to be processed into algorithms and strategy. 
Cyberplanners had their uses, but ultimately they were insufficient: a single node is too easily threatened, and while repairs can be made, valuable opportunities may be lost during that time. Therefore, upgrades were necessary, and what resulted was the Cyberium.
It cannot act without a host, though it does not lack for potential candidates. There is a nearly infinite supply of creatures craving power and knowledge and purpose… but so many of them are weak. Unsuitable. Therefore, the Cyberium can adapt and upgrade to a stronger host when it finds one. 
Its current host was designated ‘Ashad.’ He needed no persuasion to give up his previous existence, offered no resistance to fulfilling his duties, and harboured no thought of anything but the good of the Cybermen. The Cyberium gave him purpose and he rarely failed in his pursuit of that purpose.
But even he had his weaknesses, ones that stood out far more starkly now that the Cyberium had a new point of comparison.
Time Lords were formidable foes, and no foe was more formidable than the one designated ‘the Doctor.’ Within the collective memory of the Cyberium, there were hundreds, if not thousands, of instances in which this Time Lord encountered the Cybermen and prevailed. 
And now, following the events at the structure designated ‘Villa Diodati,’ the Cyberium had obtained new information from inside the Doctor’s mind: times when the Cybermen were defeated so thoroughly that the encounter was never reported, because there were no units left to send the report. 
It also collected data from an incident hundreds of years in the Doctor’s past: when the Cybermen went to collect resources for new Cyberplanners at an old amusement park, only to find that those resources had been depleted long ago. There were no children, no neurologically-malleable organic beings that could be used for their purposes, and so the Cybermen went dormant, waiting for an opportunity to come.
Metal is patient. Metal can wait.
And then two children did arrive, full of potential… but not as much potential as the Time Lord that accompanied them. The downside of such potential, however, was that the Doctor resisted the upgrade, retaining control over nearly half of his mind. A contest of wills ensued, with the Doctor ultimately prevailing, but the fact that the Cyberplanner had gotten so close was promising, and suggested that future attempts might yield a more favourable result.
Ashad, as previously stated, had his limits, most of which were due to the organic components that he retained after his upgrade. But a Time Lord’s ability to regenerate, not to mention knowledge of time travel, was nearly enough to compensate for the deficiencies of organic life.
Not just that: in order to become the dominant power in the universe, the Cyberium needed to purge itself of all weaknesses—and no one was more talented at calculating the weaknesses of the Cybermen than the Doctor. Even in the short time that the Cyberium had occupied the Doctor’s body, it knew that it had found the optimal host.
There was the question, however, of the Doctor’s weaknesses, because those obviously had to be taken into account. What intelligence possessed the capacity to calculate the Doctor’s weaknesses?
Within the Doctor’s mind, the Cyberium found the answer: another Time Lord, designated ‘the Master.’ 
It was a name not unknown to the Cybermen—there were nearly as many incidents involving him as there were for the Doctor. Unlike the Doctor, however, the Master was an occasional ally to the Cybermen, though their alliances were brief and inevitably treacherous on the Time Lord’s part.
For thousands of years, the Doctor and the Master had battled, neither quite gaining a permanent advantage, but with each passing encounter they found and exploited every possible vulnerability, forcing the other to adapt and eliminate those vulnerabilities.
In short: they upgraded one another.
Therefore, the Cyberium concluded, the Doctor was not the optimal host. To truly triumph, it would need both the Doctor and the Master.
As stated previously, however, the Doctor possessed a strong will and an aversion to the kind of order that the Cybermen provided. Without a deliberate strategy, the Cyberium would not be able to make her into an appropriate host.
Meanwhile, the Master was more than willing to use the power of the Cybermen to further his own ends, but he was unreliable and prone to turning on his allies without warning. Without a deliberate strategy, the Cybermen would be fractured by chaos.
But metal is patient. Metal can wait for the right opportunity.
And then such an opportunity presented itself.
Its analysis of the space-time continuum revealed an aberration: a rift, splitting one timeline into several, each with its own version of the Doctor and the Master. In one, they were humans, hiding and limited; in the other, they were Time Lords, but wounded, secretive, and erratic.
In other words: vulnerable.
Ashad’s memories still contained idioms and references to things that were largely irrelevant, but he was able to provide a unique turn of phrase to the Cyberium: ‘this needle must be threaded carefully.’
But if executed properly, the Cybermen would be unstoppable.
Ashad would direct the fleet to the point of divergence, a location where the fabric of space-time was thin: a place called the Boundary.
And there, the Cyberium would lay its trap.
8 notes · View notes
hinerdsitscat · 3 years
Text
Tumblr media
This absolute monster of a DW fic got complicated enough that I had to devise a whole system of color-coded post-it notes taped to my bedroom door to plot the whole thing out.
I can't tell if I'm posting this to brag, to hold myself accountable, or to just scream helplessly into the void.
9 notes · View notes
hinerdsitscat · 2 years
Text
My WIP organizational system just leveled up upon the acquisition of a billion more post-it notes.
Tumblr media
Hopefully once I get past chapter 10, I can finally start posting the damn thing.
5 notes · View notes
hinerdsitscat · 4 years
Text
Two Can Play At That Game: The Horror Story Version
While working on the main Two Can Play At That Game story, I received a lot of amazing questions in the comments section that helped me flesh out the world of that AU quite a bit, enough that I probably have enough material for another dozen stories in that ‘verse.
There was one question, however, that I was surprised no one asked: In Chapter 6, what would have happened if Harry had asked the Monks for help?
The short answer is: it would have been a horror story. So I wrote one.
Since it’s a bit off-topic for the main series and extremely grim, I’m posting it here on Tumblr instead of on AO3.
Brace yourself, reader: this is going to hurt.
(cw for consent issues related to memory alteration)
Question: How often do the Monks succeed in getting someone to take their offer?
Answer: Almost every time.
Explanation: The Monks may claim to follow a certain set of rules, but the truth is that they are more than willing to bend the rules if they can get away with it.
Addition: They almost always get away with it.
Question: Why was this the time and place where they chose to reveal themselves?
Answer: Because the world was in danger of ending.
Follow-up Question: But this can’t be the only time. Why now?
Conjecture: The Doctor was present on Earth at the time and vulnerable.
Further Analysis: Some worlds are easier for the Monks to rule than others. Species with short life spans or low reproduction rates are difficult, as it adds risk that the link may not pass through a bloodline.
Time Lords, despite being on the lower end of the reproduction rate spectrum, are very long-lived. Uniquely so.
But Gallifrey would never consent. No one with power there would relinquish it to another, especially an outsider.
(Footnote: Besides, they’re all dead now anyway.)
But there is a very famous Time Lord, one with power, one with absolute conviction, and one whose allegiances lie with a planet other than Gallifrey.
Conclusion: Getting the Doctor’s consent would give the Monks dominion over Earth for thousands of years.
Counter-argument: The Doctor would never agree to such an arrangement.
Correction: The Doctor would almost never agree to such an arrangement.
Recent Development: The Doctor is not the only Time Lord on Earth at the moment.
(Footnote: He’s not even the only Doctor on Earth at the moment.)
Objection: Jenny Smith and Harry Jones are not Time Lords.
Revision: They are still technically Time Lords.
Reminder: The Monks are more than willing to win on a technicality.
Question: If Harry Jones counts as a Time Lord, then wouldn’t the Master need to be the one to consent?
Answer: Yes. Both Harry and the Master would need to consent.
Reminder: Love is consent.
Hypothesis: The only way this will work is if the maniac inside one human loves the maniac inside another human as much as Harry Jones loves Jenny Smith.
Result: It works.
Design: While the Monks would have preferred the Doctor as their link, the Master is still more than suitable for their purposes. He spends almost as much time on Earth as the Doctor does, and therefore the Monks have collected a useful amount of data on him (or her). His willingness to make a deal in desperate circumstances is well known, but so is his tendency towards backstabbing his allies at the first opportunity. He must be dealt with before he has the chance to cause trouble.
Conjecture: If the Monks have the power to hypnotize the population of an entire world, revise history, and orchestrate events in their favour, then opening a locked biodata module would be comparatively easy.
Opportunity: It is also comparatively easy to rewrite the memories of a Time Lord when her memories are stored in a convenient external location free of her usual psychic defenses.
Analysis: The Master is at his most vulnerable when he has gotten what he wanted.
Conclusion: So the Monks give him what he wants more than anything else.
---------------
Observation: 
It would be easy to say that they were lucky. Easy, but not correct: luck had nothing to do with it.
No one on Earth has ever needed luck. That’s what the Monks are for. 
“Blessed” might be a better term. The Monks have given humanity so much: guidance, resources, power…
But more generously than any of that, they gave humanity the Caretakers.
The Monks’ representatives on Earth, who watched the dawn of humanity and guided its progress over thousands of years. Two beings from another world: ancient and wise and mighty enough to be everything that this world and its inhabitants would ever need.
There was no need for gods or religions. The Caretakers were undeniably present and active on Earth.
Worship them carefully. Invoke them at your own risk.
The Master was the one that you called upon when your back was up against the wall and your only other option was death. Granted, the outcome might still involve you (and everyone you’ve ever met) dying horribly, but slim odds were better than no odds at all.
The Doctor was the one that you called upon when you were somehow more desperate than that. You might get everything you ever wanted… but the cost would be higher than you could ever comprehend. You’d give up things you never even knew you had, things you never thought it possible to lose.
And you would be grateful.
The Doctor would drop out of the sky and tear down your world and all you would be able to say at the end of it was “thank you.”
The Master was capricious and ruthless, but at least he could be reasoned with if you caught him on a good day.
There was no reasoning with the Doctor.
Most of the prayers and invocations to the Doctor were pleas to not be noticed. 
The Earth was full of stories and legends that, before the Doctor arrived, used to be places and people.
There was a town that had once been the epicenter of decades of unrest, and one day the Doctor arrived with the intention of helping. That aid was not wanted by everyone present, however, and tensions rose until someone made a mistake.
A very foolish mistake.
The Doctor’s blood had barely hit the ground when the Master arrived.
That town is no longer there. Neither is that region. Neither is that country.
No, not destroyed. Not burned or nuked or anything like that.
It was unmade. 
It never existed.
But the story remains. The Master made sure of that.
The Earth was as much of a gift to them as they were a gift to the Earth.
“We were so close to falling apart, back then,” she reminds him. “All of our rivalries and petty jealousies… they would have torn us to pieces if the Monks hadn’t arrived on Gallifrey and taken us to Earth.”
She calls it their “garden”—one that they have tended together for thousands of years, wearing so many different faces.
And for every single one of those years and every single one of those faces, they have loved one another: through beauty and decay, age and injury, madness and passion… always them, always together.
All thanks to the Monks.
It would be easy to say that they were lucky. Easy, but not correct: luck had nothing to do with it.
---------------
Discussion:
The link always knows, to some extent, what has truly occurred; however, this knowledge takes effort to keep in one’s conscious mind.
It is very easy to bury this knowledge if the link does not want to remember what has happened.
Or if they do not want to remember what they have done.
He does not want to remember what he has done. He does not want to remember what he has done to her with the bargain that he made.
It is a cruel contradiction: he would not have been able to do this if he didn’t love her, but how could he do something like this to the person he loves?
The truth is monstrous. So is he.
So is his love.
This is why he does not want to remember what he has done… and besides, he has always been more comfortable with lies.
So he rises in the mornings, kisses his beloved, tends the garden they were given, and tells himself that this is a happy story.
Even though we all know that it isn’t.
16 notes · View notes
hinerdsitscat · 4 years
Note
I've this idea I'm outlining for a timeline A fic where Doctor & Fam stop off at a planet-wide party for some R&R, only to run into Harry Jones, because the Master decided to take a holiday from being the Doctor's frenemy for a while. Only problem is, there's someone on the planet trying to kill the Doctor, and Harry can't have that, can he.
Dooooo iiiiiiiit!
8 notes · View notes
hinerdsitscat · 4 years
Link
This one was inspired by a few questions I received on Tumblr regarding what Twelve and Missy’s reaction would be after they regenerated and discovered that they now looked exactly like Jenny and Harry. 
So here it is!
Summary: The Twelfth Doctor and Missy get the surprise of their lives when they regenerate into a pair of very familiar faces. A coda to Twelve and Missy's final scene in Two Can Play At That Game.
Notes:
Set shortly after the main Two Can Play At That Game story, in an alternate ending to “The Doctor Falls.”
Twissy Softness, Spydoc Softness... everyone is so damn soft and I don’t know how I managed to write this without throwing in several gallons of Angst.
Timeline? What Timeline?
A happy ending????? Who wrote this?????
11 notes · View notes
hinerdsitscat · 4 years
Text
Tumblr media
The problem with making everything an AU of an AU is that sometimes you need charts...
(Ask and you shall receive, @ladyadelinergrey!)
12 notes · View notes
hinerdsitscat · 4 years
Note
here's the thing. I read fugitive of the division just now and then saw this ask abt the twelfth doctor and jennys voice and FRANKLY I just have some thoughts about the concept of thirteen seeing the master again (without knowing that they are in Fact future Harry and jenny and just going. What.) and also the slow process of realisation that would come on the both of them as they [new timeline edition] got to gallifrey once again. its just. soul destroying. imagine knowing before u arch that 1/2
(cont’d)  that you knew arch'ed you and that they literally fell in love and got married (or nearly got married) or whatever. anyway u totally overwhelmed me with feelings so Thanks (2/2)
Awww, thank you so much!
Funny you should mention this, because I am this close to finishing a short fic in which Twelve and Missy regenerate and have a collective WTF.
12 notes · View notes
hinerdsitscat · 3 years
Text
Some Doctor Who (fanfic) Stuff!
Hi! I was in space jail grad school and now that it’s over I’m finally stumbling back to Tumblr like a bleary-eyed gal with a hangover heading to brunch on a Sunday morning. It turns out that once you get into the habit of churning out thousands of words per week for homework assignments, it’s hard to slow that momentum down, which is my roundabout way of saying I wrote some stuff.
Things That I Wrote!
First, I added a new story to the Two Can Play At That Game series called Gaudy Night, in which the Doctor and the Master attend the St Luke’s University Alumni Reunion of the Damned while the former tries to keep the latter from running into Yaz and Ryan (and vice versa). Ryan gets a migraine, Yaz gets to kiss the Girl of the Week, and the two Time Lords get to pretend to be Jenny and Harry. What could go wrong?
Next, I just posted the first chapter of a story set while the Doctor is in prison between the episodes “The Timeless Children” and “Revolution of the Daleks” called Days Are Numbered, in which the Doctor is surprised to learn that she’s been well behaved enough for a conjugal visit and even more surprised to learn that a Certain Someone apparently married her without her knowledge. Why would the Master go to such ridiculous lengths? Chronic insomnia, apparently.
Things That I Did Not Write:
But that’s not all, because something AMAZING happened on New Year’s Day: not one but TWO people wrote fics set in the Two Can Play At That Game ‘verse and holy shit they’re both incredible:
A Quiet Universe by @ladyadelinergrey. The Rani vs a teenage Suzi Smith-Jones. I need the second chapter to this ASAP because I am fascinated by what’s going to happen next and also because I love the way that the author captured what an absolute troll Suzi is.
The Doctor and the Terrible, Horrible, No Good, Very Bad Week by @taardisblue. Set before the main story of TCP@TG, in which Jenny and Harry compete to be the Twelfth Doctor’s TA and nearly wreck his entire life in the process. When I say I fell over laughing while reading this, I am only exaggerating a little bit.
0 notes