#rat king tara’s art

[tara-tchaisky]

Spray it with raid starscream!

#transformers #transformers fanart #fanart #rat king tara’s art #maccadam #starscream #transformers mtmte #tf mtmte #starscream idw #starscream fanart #mtmte fanart #why is he like this?

[sciencespies]

Catherine the Great's Lost Treasure, the Rise of Animal Rights and Other New Books to Read

https://sciencespies.com/nature/catherine-the-greats-lost-treasure-the-rise-of-animal-rights-and-other-new-books-to-read/

Catherine the Great's Lost Treasure, the Rise of Animal Rights and Other New Books to Read

By the end of her reign, Catherine the Great had acquired more than 4,000 paintings, 38,000 books, 10,000 engraved gems, 16,000 coins and medals, and 10,000 drawings. But as writers Gerald Easter and Mara Vorhees point out in The Tsarina’s Lost Treasure, this collection—which later formed the foundation of the State Hermitage Museum—could have been even greater. A cache of Dutch masterpieces acquired by the art-loving Russian empress vanished when the ship carrying them sank in 1771 with its priceless artwork aboard.

The latest installment in our series highlighting new book releases, which launched in late March to support authors whose works have been overshadowed amid the COVID-19 pandemic, explores the loss and rediscovery of Catherine the Great’s sunken merchant ship, a leader of the fledgling animal rights movement, the stories of three daughters of World War II leaders, humanity’s connection to the cosmos, and the life of “Black Spartacus” Toussaint Louverture.

Representing the fields of history, science, arts and culture, innovation, and travel, selections represent texts that piqued our curiosity with their new approaches to oft-discussed topics, elevation of overlooked stories and artful prose. We’ve linked to Amazon for your convenience, but be sure to check with your local bookstore to see if it supports social distancing-appropriate delivery or pickup measures, too.

The Tsarina’s Lost Treasure: Catherine the Great, a Golden Age Masterpiece, and a Legendary Shipwreck by Gerald Easter and Mara Vorhees

When Dutch merchant Gerrit Braamcamp died in June 1771, his executors held an estate sale featuring what Easter, a historian, and Vorhees, a travel writer, describe as “the most dazzling assemblage of Flemish and Dutch Old Masters ever to reach the auctioneer’s block.” Highlights included Paulus Potter’s Large Herd of Oxen, Rembrandt’s Storm on the Sea of Galilee and Gerard ter Borch’s Woman at Her Toilette. But one work eclipsed the rest: The Nursery, a 1660 triptych by Rembrandt student Gerrit Dou, who was—at the time—widely believed to have surpassed his teacher’s already prodigious talents.

Following an unprecedented bidding war, Catherine’s representatives secured The Nursery, as well as a number of other top lots, for the empress, a self-proclaimed “glutton for art.” The cultural trove departed Amsterdam on September 5, stowed in the cargo hold of the Saint Petersburg-bound Vrouw Maria alongside sugar, coffee, fine linen, fabric and raw materials for Russian craftsmen.

Just under a month after it left port, the merchant vessel fell afoul of a storm in the waters off of modern-day Finland. Though all of its crew members escaped unscathed, the Vrouw Maria itself sustained significant damage; over the next several days, the ship slowly sank beneath the waves, consigning its contents to the ocean floor.

The czarina’s efforts to recover her artwork failed, as did all salvage missions undertaken over the next 200 years. Then, in June 1999, an expedition led by the aptly named Pro Vrouw Maria Association located the wreck in a state of almost perfect preservation.

The Tsarina’s Lost Treasure deftly catalogs the fierce legal battles that ensued following the ship’s discovery. Buoyed by the tantalizing possibility that the vessel’s cargo remained intact, Finland and Russia both laid claim to the wreckage. Ultimately, the Finnish National Board of Antiquities decided to leave the Vrouw Maria in situ, leaving the question of the artworks’ fate unresolved. As Kirkus notes in its review of the book, “[I]t’s an entertaining yarn whose ending is yet to be written.

A Traitor to His Species: Henry Bergh and the Birth of the Animal Rights Movement by Ernest Freeberg

For most animals, life in Gilded Age America was fraught with exploitation and violence. Workers pushed horses to the limits of their endurance, dogcatchers drowned strays, and merchants transported livestock on lengthy journeys without food or water. Dog fighting, cockfighting, rat baiting and other similarly abusive practices were also common. Much of this mistreatment stemmed from the widespread belief that animals lacked feelings and were incapable of experiencing pain—a view that Henry Bergh, a wealthy New Yorker who’d previously served as a diplomat in imperial Russia, strongly contested.

Bergh launched his campaign for animal rights in 1866, establishing the American Society for the Prevention of Cruelty to Animals (ASPCA) as a nonprofit with the power to “arrest and prosecute offenders,” per Kirkus. As Ernest Freeberg, a historian at the University of Tennessee, writes in his new biography of the unlikely activist, some Gilded Age Americans responded with “a mix of applause and mockery,” while others “who resented this interference with their economic interests, comforts, or conveniences” fiercely resisted Bergh’s call to action.

One such opponent was circus magnate P.T. Barnum, who’d built his empire by exploiting animals and people alike. Pitted against Barnum and other leading figures of the period, the naturally theatrical Bergh often found himself subjected to ridicule. Critics even labeled him a “traitor to his species.” Despite these obstacles, Bergh persisted in his campaign, arguing that while humans had the right to use animals (he personally was fond of both turtles and turtle soup), they lacked the authority to abuse them. By the time of Bergh’s death in 1888, notes Kirkus, “[M]ost states were enforcing ASPCA–backed anti-cruelty laws, and [the] universal feeling that animals did not suffer had become a minority view.”

The Daughters of Yalta: The Churchills, Roosevelts, and Harrimans: A Story of Love and War by Catherine Grace Katz

The February 1945 Yalta Conference is perhaps best known for producing a photograph of three Allied leaders—U.S. President Franklin D. Roosevelt, British Prime Minister Winston Churchill and Soviet Premier Joseph Stalin—posing alongside each other as if they were the best of friends. In fact, these blithe smiles belied the contentious nature of the peace summit, which acted less as an affirmation of alliance than as a predecessor to the Cold War.

In The Daughters of Yalta, historian Catherine Grace Katz offers a behind-the-scenes look at the eight-day conference through the eyes of Roosevelt’s daughter, Anna; Churchill’s daughter Sarah, who was then serving in the Women’s Auxiliary Air Force; and Kathleen Harriman, daughter of American ambassador to the Soviet Union Averell Harriman. Each played a key role in the meeting: Anna helped her father hide his rapidly declining health, while Sarah assumed the role of Churchill’s “all-around protector, supporter, and confidant,” according to Katz. Kathy, a competitive skier and war correspondent, actually learned Russian in order to act as Averell’s “de facto protocol officer,” notes Publishers Weekly.

An array of personal ties compounded the many political factors already at play during the conference. Churchill’s daughter-in-law Pamela was having an affair with Averell, for instance, and Kathy had had a brief affair with Anna’s married brother. But while Katz dedicates ample space to Yalta’s interpersonal intrigue, her main focus is the women’s roles as “daughter diplomats. As she explains on her website, “Their fathers could work through them to gather information, to deliver subtle but important messages that could not be explicitly expressed by a member of the government, and to give the leaders plausible deniability on thorny diplomatic issues in which they could not be directly involved.”

The Human Cosmos: Civilization and the Stars by Jo Marchant

Humans’ fascination with the night sky is as old as civilization itself, writes Smithsonian contributor Jo Marchant in The Human Cosmos. Citing case studies as varied as Ireland’s Hill of Tara, the Native American Chumash people, ancient Assyrians who associated lunar eclipses with their king’s demise, and drawings of what could be constellations at Lascaux Cave, the journalist traces the trajectory of humanity’s relationship with the stars from prehistoric times to the present, covering 20,000 years in just 400 pages.

Marchant’s overarching argument, according to Publishers Weekly, is that technology “separates people from the actual world.” By relying on GPS, computers and other modern tools, she suggests that society has created a “disconnect between humanity and the heavens.”

To correct this imbalance, Marchant prescribes a shift in perspective. As she explains in the book’s prologue, “I hope that zooming out to survey the deep history of human beliefs about the cosmos might help us probe the edges of our own worldview and perhaps look beyond: How did we become passive machines in a pointless universe? How have those beliefs shaped how we live? And where might we go from here?”

Black Spartacus: The Epic Life of Toussaint Louverture by Sudhir Hazareesingh

As alluded to by its title, Sudhir Hazareesingh’s latest book centers on a larger-than-life figure: Toussaint Louverture, a Haitian general and revolutionary whom the historian describes as the “first black superhero of the modern age.” Born into slavery around 1740, Louverture worked as a coachman on a plantation in Saint-Domingue (later Haiti). “[I]ntelligent, daring and athletic,” writes Clive Davis in the Times’ review of Black Spartacus, he gained his freedom in the 1770s and proceeded to embark on a number of business ventures, including renting a coffee plantation staffed by at least one enslaved individual.

In 1791, enslaved people living on Hispaniola, the French-controlled half of Saint-Domingue, revolted. Though Louverture initially stayed out of the conflict, he was eventually spurred to action by both his Catholic religion and Enlightenment belief in equality. Given command of thousands of formerly enslaved rebels, the burgeoning military man soon emerged as one of the movement’s key leaders.

Afraid that the unrest would spread to its own colony of Jamaica—and eager to cause trouble for its European neighbor—the British government sent in troops to put down the rebellion. France, faced with the possibility of defeat, sought to secure the rebels’ loyalty by abolishing slavery across its colonies. Louverture, in turn, allied with his former enemy, fighting Spanish and British colonizers on behalf of France.

By the end of the century, notes David A. Bell for the Guardian, “[H]e had outmaneuvered a series of French officials, overcome black rivals, emerged as the colony’s uncontested strongman, and brought it to the brink of independence.” In doing so, Louverture attracted the attention of newly minted French leader Napoleon Bonaparte, who sent 20,000 French troops to reassert control over the island. Though the French campaign ultimately failed, Napoleon did manage to end his rival’s grasp on power. Promised safe passage to peace talks, Louverture instead found himself arrested and imprisoned in France, ​where he died in 1803—just one year before Haiti officially won its independence.

Black Spartacus draws on archival documents housed in Britain, France, the United States and Spain to present a comprehensive portrait of an oft-mischaracterized man. “Toussaint,” writes Hazareesingh, “embodied the many facets of Saint-Domingue’s revolution by confronting the dominant forces of his age—slavery, settler colonialism, imperial domination, racial hierarchy and European cultural supremacy—and bending them to his will.”

#Nature

#Nature

[binnedrubbish]

5/12/19 Notes

Lab Meeting Prep Pipeline:

(May 2nd, 2019 at 2:38 p.m.) 

[ ] Read the Results & Discussion cover to cover

[ ] Complete slides for all figures

[ ] Give a practice presentation

[ ] Read methods 

[ ] Complete fluorescence slides

[ ] Decide how to deal with ‘relationship between calcium activity and movement’ section

[ ] Give a practice presentation 

[  ] Read supplementary material cover to cover

[  ] Give a practice presentation 

Note to self: Relax.  Be meticulous.   Be disciplined.  Keep calm, do your best, trust your team.  

—— 

——

Advanced Optimization 

8 20 905

Live Action Poem, February 2nd, 6:41

Went to Brazil out of spite and saw

stone Jesus, arms open for a hug,

bought street weed, twice, from the same vendor

out of a reckless love for reckless love.

Hoped for a tropical muse and found 

a strong handshake from a dangerous man.

Holed up in Rio de Janeiro with piles

of paper money and paced all alone

angry at nothing if only for the moment.

Rain dampened slick stone walkaways,

waiters were too nice and I tipped too much.

One offered to be a bodyguard , violence

hinted in every smirking human moment.

God, I loved being a target, smug,

dumb, flitting away American Dollars.

Jesus Christ looming in stone on a hill top.

Titties and marijuana, iconic primadonna 

extravagant flora, dying fauna, fawning

over the climate. I went to Brazil

on an off month. To hole up 

safe from my sprawling little lovely life. 

To Do 26.1.19

[x] Cristina - Search for Hippocampus Models

[x] Ana G. - Draft e-mail call for interest in “Live Action Science”

[  ] 

Data science Club Thursday at 5:00 p.m. 

Astavakrasana 

laser-scanning photostimulation (LSPS) by UV glutamate uncaging. 

12.1.19 Goals

[x] Some Portuguese 

[x] Mouse Academy - first read 

[ / ] Dynamic mesolithic dopamine 

[x] Water rats * SMH

Acorn - tracks impact | BetaWorks | 2 years of money | PitchBook | Social Impact Start Up 

Mission Aligned Investors | Metrics | Costumer Acquistion Cost | Clint Corver -> Chain of Contacts -> Who To Talk to (Scope: ~100) 

Money Committed || Sparrow || Decision Analysis —> Ulu Ventures [500k] [Budget x ] 

Ivan - > IoS Engineering { Bulgarian DevShop } 

[market mapping] Metrics -> Shrug 

Peter Singer - Academic Advisory Board … 

[1 million ]

Product market testing 

Foundation Directory Online  - Targeted , Do Your Homework 

https://www.simonsfoundation.org/2018/11/19/why-neuroscience-needs-data-scientists/

Head-fixed —> 

~INHIBITION EXPERIMENT TRAINING PLAN~

STOP MICE:  20th.  GIVE WATER: 20th (afternoon) - 30th.  DEPRIVE: 31st... (Morning) RESUME: Jan 2nd.

21st - BLEACH/DEEP CLEAN BOXES 1-14 (Diluted bleach; Flush (with needles out) - Open Arduino Sketch with Continuously open Valves - PERFUSE System) *[NOT BOX 11 or 5]*; Run 15 mL of Bleach per syringe; Copious water through valves; Leave dry.

———

http://www.jneurosci.org/content/preparing-manuscript#journalclub

Friday - Dec. 14th, 2018 

[x] - Complete 2019 ‘Goals and Blueprint’ 

[x] - 2-minute Summary ‘Properties of Neuron in External Globus Pallidus Can Support Optimal Action Selection 

[  ] MatLab for Neuroscientists :: Basic Bayesian Bearded Terrorist probability plots 

[x] Statistics 101: Linear Regression 

“Golden Girls” - Devendra Banhart

“King” by Moor - FIREBEAT 

Reread - Section 3.3 to  

Monday - Apply for DGAV License (MAKE SHORT CV)

SAMPLE: ‘Sal’ From Khan Academy 

Make short CV

Tiago - Certificate 

MATH:

“We explicitly focus on a gentle introduction here, as it serves our purposes. If you are in 

need of a more rigorous or comprehensive treatment, we refer you to Mathematics for Neuroscientists by Gabbiani and Cox. If you want to see what math education could be like, centered on great explanations that build intuition, we recommend Math, Better Explained by Kalid Azad.”

Jacksonian March seizure (somatosensory) 

—

Tara LeGates > D1/D2 Synapses

Scott Thompson

Fabrizio Gabbiani - Biophysics - Sophisticated and reasonable approach 

Quote For Neuroscience Paper:

“Every moment happens twice: inside and outside, and they are two different histories.”

— Zadie Smith, White Teeth  

Model Animal: Dragonfly? Cats. Alligators. 

Ali Farke Toure 

Entre as 9 hora e o meio-dia ele trabalha no computador. 

Ele volta para  o trabalha à uma e meia.  

Ele vai as compras depois do trabalho.

A noite, depois do jantar, ele e a mulher veem televisão.

As oito vou de bicicleta para o trabalho.  (go)

As oito venho de bicicleta para o trabalho.  (come) 

A que horas começa a trabalhar?

Eu começo a trabalhar os oito e meia.

Normalmente… 

Eu caminho cerca de Lisbon.

É muito triste! Eu faço nada! Talvez, eu caminho cerca de Lisbon.  Talvez eu leio um livro.  Talvez eu dormi.    Eu vai Lx Factory.  

Depois de/do (after) 

antes de/do (before) 

—

Monday -> Mice 

MATLAB!

-

“New ways of thinking about familiar problems.” 

~*NOVEMBER GOALS*~ 

> Permanent MatLab Access [x] -> Tiago has license 

> Order Mouse Lines [ ] -> Health report requested… Reach out to Vivarium about FoxP2 

   -> Mash1 line -> FoxP2 expression?  

> Finish ‘First Read Through’ [ ] 

> Figure 40 [ ]

SAMPLE : ‘Afraid of Us’ Jonwayne, Zeroh 

Monday Nov 5th Goals: 

> Attentively watch:

> https://www.youtube.com/watch?v=ba_l8IKoMvU (Distributed RL)

> https://www.youtube.com/watch?v=bsuvM1jO-4w (Distributed RL | The Algorithm) 

MatLab License 

Practical Sessions at the CCU for the Unknown between 19 - 22 Nov 2018 (provisional programme attached)

Week of November 5th - Handle Bruno’s Animals 

Lab Goals - 

“Deep Networks - Influence Politics Around the World”

Paton Lab Meeting Archives

Strategy: Read titles/abstracts follow gut on interesting and relevant papers

Goals: Get a general sense of the intellectual history of the lab, thought/project trajectories, researchers and work done in the field and neighboring fields.

Look through a GPe/Arkypallidal lens… what can be revisited with new understanding?

First Read Through 

[x] 2011 - (22 meetings || 10/12 - SLAM camera tracking techniques)  

[ x] 2012a (18 meetings) 

 [x] 2012b (15 meetings - sloppy summary sentences)

[ x] 2013a (19 meetings - less sloppy summaries jotted down)

[x] 2013b (17 meetings) 

[x] 2014a (21 meetings) (summaries in progress)

[x] 2014b 

[x] 2015 (23 meetings)

[ ] 2016 (23 meetings) 

Current 

—

“I like, I wish, I wonder”

“Only Yesterday” Pretty Lights

retrosplenial dysgranular cx (?)

retrosplenial granular cx, c (?)

fornix (?)

Stringer 2018 arVix

Lowe and Glimpsher 

November Goals:

[  ] GPe literature - 

[ x ] Dodson & Magill

[  x] Mastro & Gittis

[  ] Chu & Bevan 

[x] Modeling (extra credit -Bogacz)

[  ] Principles of Neural Science: Part IV

[ x ] MatLab license… Website program… 

Extra credit:

Side projects [/ ] Neuroanatomy 40

[ -> ] ExperiMentor - Riberio, Mainen scripts… Paton! -> LiveAction Science

MACHINE LEARNING 

Week of Oct 29th - 

Symposium Week!

Wyatt -> John Hopkins -> He got into American University! 

Belly Full Beat (MadLib album Drive In) 

“The human brain produces in 30 seconds as much data as the Hubble Space Telescope has produced in its lifetime.” 

Sequence of voltage sensors -> ArcLite -> Quasar -> Asap -> Voltron -> ???

Muscarine -> Glutamate 

Ph Sensitive 

cAMP

Zinc sensitive 

5 ways to calculate delta f

2 main ways 

SNR Voltage — 

Dimensionality reduction of a data set: When is it spiking?

5 to 10 2-photon microscope open crystal 

…Open window to a million neuron…

Week of 10/15/18

Monday: Travel

Tuesday: Rest

Wednesday: Begin rat training.  Reorient.

Thursday:

Friday:

|| Software synergistically ||

—————

Beam splitter, Lambda, diacritic 

1.6021766208×10−19

‘sparse coding’

Benny Boy get your programming shit together. 

Week of Oct. 8th, 2018

10/9/18

[  ] Rat shadowing (9:30 a.m.) -> Pushed to next week 

10/8/18

[x] Begin Chapter 13 of Kandel, Schwartz, Jessell

[x] Outline of figure 36

[  ] Read Abdi & Mallet (2015) 

DOPE BEAT MATERIAL - Etude 1 (Nico Muhly, Nadia Sirota) 

Saturday - Chill [x]

Friday - ExperiMentor … mehhhhh scripts?  

Photometry -> Photodiode collects light in form of voltage (GCaMP) (TtdTomate as Baseline… how much fluorescence is based on TdTomatoe, controlling factor always luminesce - GCaMP calcium dependent) :: Collecting from a ‘cone’ or geometric region in the brain.  Data stored and plotted over time… Signals must be corrected… 

Cell populations are firing or releasing calcium.  (GCaMP encoded by virus injection, mice express CRE in a particular cell type).  

———————————————

———————————————

Brain on an Occam’s Razor,

bird on a wire, 

synaptic fatalism integrating 

consistent spiking;

strange looping: is this me? 

Thursday 

“We don’t make decisions, so much as our decisions make us.”

“Blind flies don’t like to fly”

[x] 9:00 a.m. Lab Meeting

[x] 12:00 p.m. - Colloquium

“It was demeaning, to borrow a line from the poet A. R. Ammons, to allow one’s Weltanschauung to be noticeably wobbled.”

“You must not fear, hold back, count or be a miser with your thoughts and feelings. It is also true that creation comes from an overflow, so you have to learn to intake, to imbibe, to nourish yourself and not be afraid of fullness. The fullness is like a tidal wave which then carries you, sweeps you into experience and into writing. Permit yourself to flow and overflow, allow for the rise in temperature, all the expansions and intensifications. Something is always born of excess: great art was born of great terrors, great loneliness, great inhibitions, instabilities, and it always balances them. If it seems to you that I move in a world of certitudes, you, par contre, must benefit from the great privilege of youth, which is that you move in a world of mysteries. But both must be ruled by faith.”

Anaïs Nin

[  ] MatLab trial expires in 1 day * 

[  ] 3:00 p.m. pictures

“We do not yet know whether Arkys relay Stop decisions from elsewhere, or are actively involved in forming those decisions. This is in part because the input pathways to Arkys remain to be determined.”

These studies prompt an interesting reflection about the benefits and conflicts of labeling and classifying neurons at a relatively grainy level of understanding.  

“The authors hypothesize that under normal conditions, hLTP serves an adaptive, homeostatic role to maintain a healthy balance between the hyperdirect and indirect pathway in the STN. However, after dopamine depletion, pathologically elevated cortical input to the STN triggers excessive induction of hLTP at GPe synapses, which becomes maladaptive to circuit function and contributes to or even exacerbates pathological oscillations.”

To Do Week of Oct. 1st - Focus: Big Picture Goals

[ x ] GPe Literature - Hernandez 2015 & Mallet 2016 (Focus on techniques and details)

[  ] MatLab! Lectures 6-7 (Get your hands dirty!)

[ x ] Kandel Chapters 12 - 13 

Tuesday Surgery Induction 10:00 with Andreia 

6:00 - 7:30 

Portuguese

Digitally reconstructed Neurons: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5106405/

To Do Week of, September 24th, 2018 

To Do Week of  Monday, September 17th, 2018

PRIORITY: 

DATA ANALYSIS PROJECT ITI 

———— PAUSE. ———————

Talks 

[x ] Mainen Lab - Evidence or Value based encoding of World State/Probability - ‘Consecutive failures’ - easy/medium/hard estimate of where the reward will be.  

Reading for the Week

[x] Chapter 9 - Propagating Signal | The Action Potential

[/ ] Ligaya et. al (2018)  (CCU S.I.?)

[x] Katz & Castillo (1952) Experiment where they describe measurement techniques

[  ] Raiser Chapter 4 - Stimulus Outlasting Calcium Dynamics in Drosophila Kenyon Cells Encode Odor Identity 

Video Lectures

[—  ] Linear Algebra (Trudge steadily through) 

[ — ] Khan Academy Logarithms (Trudge steadily through) 

MatLab

[  ] Trudge steadily through www.mathworks.com/help/matlab/learn_matlab 

*FIND PROBLEM SET/TEXT BOOK/WORK SHEETS*

Concepts to Grasp

[ / ] Master logarithms!

[  ] Review Kandel Et. Al  Part II *Chapters 5-9*

Neuroanatomy

[ x ]  Ink Figure 28

Project Planning?  Too soon! Too soon! Read some literature on the subject.  

17/9/18

1:00 p.m. Meet with Catarina to discuss “CCU Science Illustrated” (WIP) Project

2:30 p.m. Vivarium Induction 

_______________________________________________________

|      SPCAL Credentials     |

|   |

| login: |

| PW:   |

-————————————————————————

——

NPR:: https://www.npr.org/sections/health-shots/2018/09/11/644992109/can-a-barn-owl-s-brain-explain-why-kids-with-adhd-can-t-stay-focused

9.13.18

[ x ] Pauses in cholinergic interneuron firing exert an inhibitory control on stratal output in vivo (Zucca et. al  2018)

[ x ] Chapter 8 - Local Signaling: Passive Properties of 

-> Sub and supra threshold membrane potential (Conceptual) 

Monday, Sept. 10th 2018

“Eat the Frog First”

[ N/A ] Review SPCAL Lessons 1-5 (In Library?) CRAM THURSDAY? 

-> [/] wait for confirmation from Delores for theoretical test 

-> (Out of Office reply from person in charge)

To Do:

[/] Comment Out %PRE_PROCESS_vBeta.m 

[x] Change path name and run program in MatLab

[  ] Solve trial.blahblahblah error spkCount?  labels?

[  ] Change Epochs and run? 

[x] Chapter 7 - Membrane Potential :: Return to Pg. 136-137 Box 7-2 when sharp. ::

[x] Castillo and B. Katz (1954) 

[x] 12:00 - Neural Circuits for Vision in Action CCU

[x] 2:30 - THESIS DEFENSE: Mechanisms of Visual Perceptions in the Mouse Visual Cortex 

————

Extra-credit

[x] Ink Figure 24

[~ ] Finish “First & Last 2017” (100/127 = 78.74%)

——

Jax Laboratory Tools: https://www.jax.org/jax-mice-and-services/model-generation-services/crispr-cas9

Recommendation for Design and Analysis of In Vivo Electrophysiology Studies 

http://www.jneurosci.org/content/38/26/5837

On the Horizon: 

Schultz (1997) (Classic, classic, classic) 

*[x] 9/7/18 - 6:00 p.m. Flip water for Bruno’s mice *

ITI Data Analysis -> Next step ->…. 

[  ] (find the sigmoid call) /  Poke around preprocessing_beta 

Reading 

[x] Chapter 6 - Ion Channels

[ / ] Finish Krietzer 2016 —> [  ] write an experiment-by-experiment summary paper

Resource: https://www.youtube.com/watch?v=GPsCVKhNvlA Helpful explanation of ChR2-YFP, NpHR, and general ontogenetic principles.

[ / ] Reiser Chapter 3.3.38 - 3.4 (Need to finish 3.4.5, Look up Photoionization detectors, Coherence) 

Neuroanatomy

[/]  Finish Figure 24 (need to ink)

“Drawing Scientists “

[/] Storyboard for GCAMP6s targeted paper 

-> Show Filipe for feedback ->

-> Ask Leopold permission ? Talk to Catarina 

[  x] 16:9 

[x] Write script and record [ 1:00 ] 

Intellectual Roaming

[ / ] Return to Review of Reviews and Review Zoom-In | First & Last | 

[/] Explore Digital Mouse Brain Atlas 

9/6/18 - Thursday 

To Do: 

ITI Data Analysis :

[x] Draw data structure on mm paper -> Reach out for help understanding 

[ / ] What fields did Asma call?  What fields are necessary for a psychometric curve

Reading 

[x] Kandel - Chapter 5 | Synthesis and Trafficking of Neuronal Proteins 

[ / ] Reiser - Chapter 3 | A High-Bandwidth Dual-Channel Olfactory Stimulator for Studying Temporal Sensitivity of Olfactory Processing (Results complicated) 

[/ ] Krietzer 2016 - Cell-Type-Specific Controls of Brainstem Locomotor Circuits by Basal Ganglia

Talks:

[x] 12:00 p.m.  - Colloquium - Development of Drosophila Motor Circuit 

Tutorials: 

~ [x ] MatLab plotting psychometric curves 

Neuroanatomy 

[ x ] Outline brain for figure 24

———

MatLab

Laser stuff HZ noise, thresholds, 

// PCA -> Co-variance -> 

// Linear regression | Geometric intuition -> “What is known to the animal during inter-trial?  What features can be described by animals history”  ===> Construct a history space (axis represent different animals history ex. x-axis previous stimulus, reward, etc.?)  Predictive (?)  

Plot psychometric functions || PSTH (post stimulation of histogram )  of example neurons -> skills: bin spiking, plot rasters, smoothing (if necessary) 

Data:: Access to Dropbox -> /data/TAFC/Combined02/ [3 animals :: Elife] 

/data/TAFC/video

Tiago and Flipe know the video data

File Format -> Parser/Transformation (guideline) || 

> MatLab

Access to MatLab -> [/] 28 days!

How can I begin to analysis?

History dependent | Omitted 

——

To Do Week of September 3rd

Monday

Administrative

[ x] Check-in with HR (Don’t bombard!): Badge.   (Library access?) 

[  ] Reach out to SEF?

[x] 2:00 p.m. Meet with Asma - discuss data analysis.  Where is it?  How do I access it (Tiago?)  What has been done and why?

[x] 3:00 p.m. Lab Meeting “Maurico’s Data” - Pay special attention 

[x] Finish first read through of Theoretical Laboratory Animal Science PDF Lectures

[  ] Rat Surgery Techniques…

Mouse neuroanatomy project

[/ ] Figure 24

[  ] Figure 28

Math 

[x ] L.A. Lecture 2

[ x] L.A. Lecture 3 

Read:

[  ] Georg Raiser’s Thesis (Page 22 of 213)

Find time to do at least an hour of quiet focused reading a day.  (Place?).

Continue to explore whims, papers, databases, ideas, protocols, that seem interesting. 

Develop ‘literature scour’ protocol - (Nature Neuroscience, Neuron, Journal of Neuroscience) 

Dates to Remember: September 14th - Laboratory Animal Sciences Theoretical Test! 

https://www.sciencedaily.com/releases/2018/08/180827180803.htm:Can these be used for techniques?  

https://www.sciencedaily.com/releases/2018/08/180823141038.htm ‘Unexpected’ - Unexpected physical event and unexpected reward or lack of reward (neuronal modeling of external environment) 

—

In my first ten minutes at work I’m exposed to a weeks (month/year/decade) worth of interesting information.  Going from an intellectual tundra to an intellectual rain forest.  

1460 proteins with increased expression in the brain: Human Protein Atlas https://www.proteinatlas.org

Non-profit plasmid repository: https://www.addgene.org 

Protein database: https://www.rcsb.org/3d-view/3WLC/1

Started to think at the molecular level.   

“MGSHHHHHHGMASMTGGQQMGRDLYDDDDKDLATMVDSSRRKWNKTGHAVRAIGRLSSLENVYIKADKQKNGIKANFKIR

HNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGTGGSMVSK

GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDF

FKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLPDQLTEEQIAEFKEAFSL

FDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKGSYRDTEEEIREAFGVFDKDGNG

YISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK” - CCaMP6m amino acid code. 

  8/31/18 - (Friday) @12:00 in Meeting Room 25.08

GET USB ! ! 

[Lisboa Cultura na ru, Lisbon on the streets Com’Out Lisbon - Katie Gurrerirra ]

MatLab -> Chronux Neural Analysis 

SEPTEMBER 14th!

Week of August 27th, 2018

“Conserved computational circuitry, perhaps taking different arguments on different locations of Basil Ganglia” - Tuesday 

Andrew Barto: http://www-all.cs.umass.edu/~barto/

Basil Ganglia Labs

Okihide Hikosaka Lab: https://irp.nih.gov/pi/okihide-hikosaka

Wilbrecht Lab

Uchida N.  (ubiquitous dopamine motivation and reward) 

Peter J. Magill

Schultz (Pioneer in the field)

C. Savio Chan 

Doya, K. (theory) 

Calabresi, P. (muscarinic) 

Ana Graybiel (McGovern) 

James C. Houk (1994 - Book on Models of Computation in the basal Ganglia)

Evolutionary Conservation of Basil Ganglia type action-selection mechanisms: 

https://www.sciencedirect.com/science/article/pii/S0960982211005288

Dopamine D1 - Retinal Signaling https://www.physiology.org/doi/full/10.1152/jn.00855.2017 [Note to self: Too Off Track]

[ ~ ] Flurorphore Library

Official Badge? [  ] Printer Access [  ]?

—

Online Course on Laboratory Animal Science 

Monday  : 11 [x] 12 [x] 

Tuesday : 13 [x] 14 [x] 

Wednesday: 15 [x] 16 [/] 

Thursday: 17 [x] 18 [x]

Friday: 19 [x] 20  [/] 

Lesson 11 - Behavior and Environment, animals must be housed in an environment enriched to maximize their welfare. 

Lesson 12 - Rodent and Lagomorph Accommodation and Housing - A more comprehensive guide from the macro environment, facilities i.e. establishments, to the micro environments.  Covers health and safety procedures for personnel as well as geometry of housing units (rounded edges to prevent water accumulation).  Absolutely essential.  

Lesson 13 - Collecting Samples and Administrating Procedures - covers the most common collection techniques and materials collected and stressed the importance of doing as little harm as possible to the animal.  

Lesson 14 - Transporting the Animal : Shipper holds most of the responsibility.  Major goals are making sure the journey is as stress free as possible, contingency plans are in place, and that all of the logistics have been carefully planned, communicated, and coordinated between various parties responsible in the shipping.  Also, animals should be prepared mentally and physically for the journey and should have a period of post-transportation to adjust to the new surroundings and environment.  A number of practical issues must be considered such as temperature, availability of food, and access to animals during the journey.  Boxes should be properly labelled in whatever languages are necessary. 

Lesson 15 - The purpose of feeding and nutrition is to meet the energy needs of the animals, which vary by species, physiological state of animal (growth, maintenance, gestation, and lactation).  A number of category of diets exist as well as a variety of specific diets to best fits the needs of the experiment.  This chapter covers particulars of nutrition requirements and stresses the importance of avoiding obesity and malnutrition.  

Lesson 16 - Anatomy and Physiology of Teleosts (Skip for now: Focus on Rodents and Lagomorphs)

Lesson 17 - Anatomy and Physiology of Rodents and Lagomorphs - General characteristics of the anatomy and physiology of six species, 5 rodents and 1 lagomorph.  Mice, rats, guinea pigs, gerbils, and hamsters.  Rabbits.  It covers particularities of each species and has a quiz asking specific facts, mostly centered on commonalities and distinguishing factors.  Worth a close read.  

Lesson 18 - Anaesthesia and Analgesia in Rodents and Lagomorphs . Pre anaesthesia techniques, drug combinations, and repeated warning of the importance of choosing the right drugs and technique for the species.  Use of a chamber.  Methods of anesthesia (IP, IV, Volatile).  Endotracheal Intubation for rabbits; the proper use and administration of analgesics; monitoring during the operation (for example - the paw pain reflex disappears in medium to deep anesthesia 

Lesson 19 - Animal Welfare and Signs of Disturbance - This chapter repeatedly stresses the importance of the relationship between the caretaker and the animal.  It repeats the ideal social, environmental, and nutritional environments for rodents and rabbits and highlights peculiarities of each species.   After reading this one should be better suited to detecting stress, disease, or other ailments in a laboratory animal.  

Lesson 20 - Fish Psychology and Welfare (Skip for now: Focus on Rodents and Lagomorphs) 

Lessons 5, 17, and 20 pertain to fish 

TEST SEPTEMBER 14th 

—

MIT Open Course Ware:

Linear Algebra 

Lecture 2 [/ ] -> Elimination by Matrices, production of elementary matrices, basic computations, and a review of row and column approaches to systems of equations.  Introduction to the basic application of the rule of association in linear algebra.  

Lecture 3 [ ]

Mouse Neuroanatomy 

Ink Figure 16 [x]

Figure 20 [x]

Figure 24 [  ]

Introduction to MatLab:  https://www.youtube.com/watch?v=T_ekAD7U-wU [  ] 

Math Big Picture: Review Single Variable Calculus!  Find reasonable Statistics and Probability Course (Statistical Thinking and Data Analysis?  Introduction to Probability and Statistics?) Mine as well review algebra well I’m at it eh.  

Breathe in.  Breathe out.  

—

Data analysis :: Behavioral Analysis 

—

Ana Margarida - Lecture 6 - Handling Mice techniques 

EuroCircuit can make a piece.  Commercial v. DYI version of products.  

Dario is the soldering, hardware expert.  I.E. skilled technician. 

www.dgv.min-agricultura.pt; it is recommended that the entry on Animal Protection and the section on Animals used for experimental purposes be consulted first. 

—

Sir Ronald Fisher, stated in 1938 in regards to this matter that “To consult the statistician after an experiment is finished is often merely to ask him to conduct a post mortem examination. He can perhaps say what the experiment died of”. 

——

Finally, it is time to publish and reveal the results. According to Santiago Ramón y Cajal, scientific writers should govern themselves by the following rules: 

Make sure you have something to say; Find a suitable title and sequence to present your ideas; Say it; Stop once it is said. 

8/21 Goals

Access ->

:: Champalimaud Private Internet [HR]  Printer [HR]

:: Web of Science (?)

:: PubMed (Nature, Journals, etc.?) 

:: 

———

PRIORITY:  Online Course -> Animal Laboratory Sciences PDF’s 

20 total -> 4 a day || I can finish by Friday 

Monday  : 1 [x] 2 [x] 

Tuesday : 3 [x] 4 [x ] 

Wednesday: 5 [x*] 6 [x] 

Thursday: 7 [x* ] 8 [x]es

Friday: 9 [x ] 10 [x ] 

Notes:

Lesson 1 - Philosophical and ethical background and the 3 R’s

Lesson 2 - Euthanasia.   Recommended, adequate, unacceptable.  Physical or chemical.  Chemical - inhalable or injectable.   Paton Lab uses CO2 and cervical dislocation.   

Lecture 3 - Experimental Design.  Return to as a starting point for basic design (randomized samples and blocks) Integrate with “Statistical Thinking and Data Analysis”

Lecture 4 - Legislation.  Memorize specific laws and acts.

Lecture 5 is highly specific for the care and maintenance of Zebrafish

Lecture 6 - Handling of rodents and mice.  A theoretical overview, this material is essentially kinesthetic.  

Lecture 7 - Provides a technically detailed account of how genetic manipulations are done and propagated.   Deserves a ‘printed’ review and vocabulary cross reference.

Lecture 8 - Health and Safety.  Predominantly common sense.   

Lecture 9 - Microbiology - contains an appendix with list of common infections that will be eventually be good to know.

Lesson 10 - Anaesthesia pre and post operation techniques, risks of infections etc. 

// http://ec.europa.eu/environment/chemicals/lab_animals/member_states_stats_reports_en.htm

http://ec.europa.eu/environment/chemicals/lab_animals/news_en.htm -> General European News regarding 

http://www.ahwla.org.uk/site/tutorials/RP/RP01-Title.html -> Recognizing pain in animals 

Week of 8/20/18 To Do:

Tiago/Team -> Whats the most important priority?

Get Arduino Machine working again [?]

Jupiter/Python Notebook Up [ ]

Bruno MatLab Access [… ]

 - Get documents to HR

 - Animal Lab certified?

 - Logistical/Certificate/Etc.  

  - Start discussing personal project: 

    >  (Rat colony) Wet Lab

    > (Machine Learning) Electric Lab

    > Statistics project

  - Reacquaint with Lab Technology/Protocols 

  - Review papers - Engage back with the science 

  - 

Project Print: Screen shots

[  ] collect 

“Do the job.  Do it engaged.   Engage -> Not just execute the best you can, understand the experiment.

Why? Alternative designs?  Control experiments needed to interpret the data?  Positive controls and negative controls?  What do you need to do to get crisp.  Totally engage.  

How it fits into other experiments?  

“Engage with the science as if it were your baby.”

Execute beautifully… Ask --- et. al.  What does ideal execution look like 

Extra time: allocate time.  Technicians : Freedom to do other things, work with other things, other technical things, giving people independent project to carry out.    Project --- has in mind?  Design.   Hands on education of how science works then reading.   Spend time focused on a problem and in the ideal become the world’s foremost expert on whatever ‘mundane’ aspect of what ever problem you are working on.

Computational in the context of a problem.  Learn to use.   Defining “problems I want to solve.”   As an operating scientist, the technology can change very quickly.   Capable of learning, understanding, and applying.  

Answer questions in a robust way.  Thinking of technology in context of problem.   Deep domain knowledge; focus on experimental more than book reading.   

Realistic path -> Research fellow to PhD. program.  Industry…  Strong head’s up to do research.   First-rate OHSU?  Excellent.    IF: Remember that it is narrow, broader with neuroscience as a component.   Biology < > Neurology.   Real neuroscience computational ->

Juxtasuposed: Engineering, CS, A.I., and all that…

Label in broad ways: Molecular, cellular, systems, cognitive, psychology.   Borders are so fuzzy — as to be 

Domain bias.   In general -> other than P.I. protected from funding.  Publication, the life of the business.   Metric of success is the science they publish.    Work that contributes to being an author = more engaged, more independent.   Evolved to an independent project.    

So incredibly broad -> CRISPR, GFP, Optogenetics, with higher level systems problems.   100 years = absurd.   Look back -> Could we have conceived whats going on today.  

Foremost expert on something how-ever limited.  Grow from there.   Grown from a particular expertise.    

Molecular biologist || Do what a 3 year old is taught to do.  How?  How?  How?  How does that work.  Quantum physics.   Ask questions.  Be open.   

Go to seminars  -> Go to every talk.  Take every note.  Primary literature fundamentally different.   Always learn in context.  Don’t dilute too much (ignore title, abstract, discussion).  Look at figures and tables and derive for yourself what they say.   Look for THE FIGURE or THE TABLE that is the crux and look for the control experiment.    Understand the critical assessment, are the facts valid and warranted?  Infinite amount to learn, don’t spread yourself infinitely thin.  “ 

 To Do: Develop Independent Machine Learning Project 

Gain Access to Web of Science 

————

Paton Learning Lab

Personal Learning Goals 

September 1st - December 1st 

Major Goals 

[  ] Read Principles of Neuroscience 5th Edition

[  ] Complete CSS 229 

[  ] Deep read 12 papers (Write summary || Practice peer review)

Administrative

[  ] Reactivate 

[ / ] Figure out Residence Permit/Visa

Lifestyle

[ x ] Purchase commuter bicycle

[ / ] Purchase waterproof computer/messenger bag

Language

[x] …. Focused practice minimum 20 minutes daily …? 

[  ]   Find language partner 

[  ] Portuguese film/television/music 

UPCOMING

Phone conversation with --------

Tuesday, August 7th 9:00 a.m. EST (10:00 a.m. 

[shelleyseale]

Coachella 2019 lineup announced: Ariana Grande, Tame Impala and Childish Gambino to headline

Coachella Valley Music and Arts Festival returns to the Empire Polo Club in Indio, CA for two weekends set for April 12th–14th and April 19th–21st. Childish Gambino, Tame Impala and Ariana Grande will headline both weekends. With its unique atmosphere of creativity, lifestyle and green awareness, the festival is a regular fixture on the festival calendar for stars and fans alike. The event, set in the Californian desert, is considered a creative melting pot, where trends and currents are born and divined. It's a cultural happening; over six days, almost 200 acts will perform for thousands of visitors from around the world. BMW, the official partner of Coachella, is building anticipation for the festival on social media with #roadtocoachella and unveiling a super cool, unique Coachella design for its BMW i models, created by Portugal. The Man lead singer John Gourley. John Gourley of Portugal. The Man creates the exclusive design for the BMW i models on the #roadtocoachella.   

Passes for Coachella go on sale Friday, January 4 at 11 AM PT at coachella.com, while supplies last. All taxes, shipping and fees are included in listed pass prices. While it wasn’t unexpected that Grande, a pop superstar who had an epic year in 2018, would be performing at the annual dessert concert, the announcement of Idris Elba was a major surprise — and sent the Twittersphere into overdrive. Did you know Elba is also a DJ? Artists like Khalid, Zedd, Kid Cudi, Janelle Monae, and the 1975 will be joining the headliners at the festival. The complete Coachella lineup in ABC order (as of January 2nd) is listed below, but you can also listen to a playlist here!

070 Shake 88Glam Adriatique Agoria Alice Merton Âme Amelie Lens Anderson.Paak & The Free Nationals Anna Lunoe Aphex Twin Ariana Grande A R I Z O N A Bad Bunny Bakar Bassnectar Bazzi Beach Fossils Billie Eilish BLACKPINK Blond:ish Blood Orange Bob Moses boy pablo Burna Boy Calypso Rose CamelPhat Charlotte de Witte Charlotte Gainsbourg Childish Gambino CHON Chris Lake Christine and the Queens CHVRCHES Cirez D Clairo CloZee Cola Boyy Dave P. Deep Dish Dennis Lloyd Dermot Kennedy Dillon Francis Diplo DJ Snake Dusky dvsn Easy Life Ella Mai Emily King FISHER FKJ Four Tet Gesaffelstein Gorgon City Gryffin Gucci Gang Guy Gerber Heidi Lawden H.E.R. Hop Along Hot Since 82 Hurray for the Riff Raff HYUKOH Iceage Idris Elba J Balvin Jaden Smith Jain Jambinai Jan Blomqvist Janelle Monáe Jauz Javiera Mena Jon Hopkins JPEGMAFIA Juice WRLD Kacey Musgraves Kaytranada Kayzo Kero Kero Bonito Khalid Khruangbin Kid Cudi King Princess Kölsch Las Robertas Lauren Lane Lee Burridge Let's Eat Grandma Little Simz Lizzo Los Tucanes De Tijuana Mac DeMarco Maggie Rogers Mansionair Men I Trust Mon Laferte Mr Eazi Murda Beatz NGHTMRE Nic Fanciulli Nicole Moudaber Nina Kraviz Nocturnal Sunshine Nora En Pure Ocho Ojos Ookay Parcels Patrice Bäumel Perfume Playboi Carti Polo & Pan Pusha T RAT BOY Razorbumps Rico Nasty Rosalía Ross From Friends RÜFÜS DU SOL Sabrina Claudio SALES serpentwithfeet SG Lewis Shallou shame Sheck Wes SiR Smino SOB X RBE Soccer Mommy Social House SOFI TUKKER Solange SOPHIE Soulection Steady Holiday Stephan Bodzin Still Woozy Superorganism Tale Of Us Tame Impala Tara Brooks The 1975 The Frights The Garden The Interrupters The Messthetics The Red Pears Tierra Whack Tomasa del Real Turnover Turnstile Ty Segall & White Fence Unknown Mortal Orchestra U.S. Girls Virgil Abloh Walker & Royce Wallows Weezer Wiz Khalifa Yellow Days YG Yotto Yves Tumor Zedd Read the full article

#ArianaGrande #BMW #ChildishGambino #Coachella #Coachella2019 #Coachellalineup #events #IdrisElba #JohnGourley #musicfestival #PortugaltheMan #TameImpala

[ulyssesredux]

Lestrygonians

Ten years ago. Orangegroves for instance. Could see her in front. Tastes fuller this weather with the Chutney sauce she liked.

Must be in the Master of the Irish house of parliament a flock of pigeons flew. Nosey numbskull. Shabby genteel. Go, hide thy beams! Can't bring back time. Cruel.

Still I got to know someone on the run all day, walking along the gutters, street after street. 'Tis common: a pox of wrinkles!

He swerved to the pupil age of two. Then, dear. Why, so just, and an umbrella dangled to his stool, with other incident throes that nature's fragile vessel doth sustain in life's uncertain voyage, I rob the thieves and go not, I can purge Myself of many I am e'en sick of shame, that labour on the menu. Val Dillon was lord mayor. Must go back to then? What's the news: you, my lord, you gods! First sweet then savoury.

This boy lends mettle to us; not to see the bluey silver over it. It is not so much, I do conceive. Crème de la crème.

I fed the birds, and I will dispatch you severally: you shall hear in such a flood of greatness to be manifold,—by the stones. Trouble for nothing can seem foul to those that win. Make the meat.

—Wife well? Secure thy heart, head in? If you imagine it's there you can almost see it.

No. For near a month, man, the nurse told me. It grew bigger and bigger.

Didn't you see my gelding out of thee.

Who's dead, who all thy safety were remotion, and call it black. Gasballs spinning about, crossing each other, passing away, and minister in their forehead perhaps: kind of colic pinch'd and vex'd by the bridgepiers. Plagues incident to men; Hate all, die merrily.

I drop into old Harris's and have him spend less; and thus far I confirm you. Indeed, my lord. There comes with them, that poor child's dress is in trouble? In the pink, Mr Bloom on his high horse, cocked hat, puffed, powdered and shaved.

No matter what; he's a sworn rioter; he owes for every grize of fortune. What is it!

He always walks outside the lampposts. I lay, full, chewing the cud. That last pagan king of honour. The rain kept off. On Wednesday next our council did decree in forwarding this dear expedience.

—Read that, to do, than my condition, which I shall lack friends?

He went on his brain. Safe! That I had the world have forgotten to come to offer you our service.

Cityful passing away, the feety savour of green cheese. Mr Bloom came to Kildare street.

Dosing it with new zest. Anon, anon, sir.

My heart's broke eating dripping. 'Bove all others? His second course. Pray God you were in Lombard street west. Lord have mercy on your wife. —I'm sitting anyhow, Nosey Flynn made swift passes in the winepress grapes of Burgundy.

A diner, knife and fork to eat the scruff off his own head?

Other steps into his seat, as on the bed.

Terrific explosions they are for law; he speaks is all a liberal course allows; who, Douglas: by my faith, thou sayest true, lad. Postoffice. Chamberlain on a dusty bottle. Of course it's years ago. O rare! My lord,—which will be too hard for us. Is he in the winepress grapes of Burgundy. They are welcome,says she, 'how many hast thou there? Russell. Gave Reuben J. His smile faded as he spoke earnestly. Or the inkbottle I suggested to him but breeds the giver a return exceeding all use of quittance. Women too. Crème de la crème. A sixpenny at Rowe's? The firing squad. The gods confound them all. Also smoke in the trial of his has been this month. Those poor birds. The devil on moneylenders.

Sloping into the sunlight through a heavystringed glass. Kissed, she said. —He had a base barreltone voice. The gods confound—hear me, my lord fool, out. Instinct.

His heart astir he pushed in the white stockings. Y. 'Zounds! Fag today. All heartily welcome. That was a nice nun there, and food for—our house, my lord. No meat and milk together. His gorge rose. First sweet then savoury. The heavy noonreek tickled the top of Mr Bloom's eye followed its line and saw a rowboat rock at anchor on the roof of the bank to test those glasses by. Sandwich? —Thank you. Or the inkbottle I suggested to him, and a scourge for me, thou knowest he's no starveling. I not take mine ease in mine honesty. Flap ears to match.

Thou art perfect. Rummaging.

Tara: bom bom bom.

Commend me to; homo is a kind of will or testament which argues a great strawcalling. Nine she had two years ago. Rats get in too. All!

But I know thee not that, if it was done, to horse!

If a fellow was trying to get it over. Safe! Alcibiades, Thou mightst have sooner got another service: for if I were now as cheap as stinking mackerel.

Those poor birds. Licensed for the night, she said.

Still, I am to thank God on. I'll give thee the spirit of persuasion and him the day. I'm sorry to hear his monstrous devices. —Quite well, I perceive, men, so he that brought them, betray with them, the very brink of tears: lend me thine. Who distilled first?

I was not half so kind that he is old, the nurse told me.

Sir John, my Lord Northumberland should be the day serves, before black-corner'd night, pray to her at Limerick junction. We know him for south Meath.

This, in thy gilt and thy place shall be here or no. —That cursed dyspepsia, he speaks the common tongue, can make bacon of that priestylooking chap was always squinting in when he passed? His midriff yearned then upward, sank within him, but stand against anointed majesty. Sunwarm silk.

—That so? Yes.

Look straight in her lap.

Near! Not logwood that.

And yet you were of our throne. Wellmannered fellow. His midriff yearned then upward, sank within him, thinkest thou? Chump chop from the vegetarian. Regular world in itself. Thou shouldst desire to know someone on the Tuesday Mr Bloom said. If he do not beat thee, and write in thee thy latter spirits: though sometimes it show greatness, courage, blood,—why, give thee for it is. But, I fear thy father? Fare thee well: here is some burden: Thy nature did commence in sufferance, time Hath made thee hard in 't. Out. Looking down he saw the fortune of ten thousand pounds. Safe in a hand-saw: ecce signum!

Do the grand. A pallid suetfaced young man, watchful among the trembling reeds, and all the budding honours on thy side, try fortune with him, but leave without thy rage: Spare thyAthenian cradle, and oft thou shouldst, thou'dst anger ladies. What? Sad to lose the old beldam earth, and now he's in Holles street where Mrs Purefoy! O! That was a nice nun there, Nosey Flynn said. No care, no more bring out ingrateful man, watchful among the warm sweet fumes of Graham Lemon's, placed a throwaway in a thousand leagues from hence. His downcast eyes followed the high figure in homespun, beard and bicycle, a plaining hand on his helm,—bid 'em send O' the mount is rank'd with all the way. People in the head. I do beseech your lordship. She's taking it home to his lips with two wipes of his boots had ceased Davy Byrne answered.

What is it not?

I so lavish of my presentment, sir! Sirrah, if we should think so: and for womanhood, Maid Marian may be for never a king's son!

Depart. Looking up from the hearth unclamping the busk of her dress: daub of sugary flour stuck to her; whose self-same mettle, Whereof thy proud child, arrogant man, a flatcut suit of herringbone tweed. That Glendower were come. How! Must be in a marketnet. What we can, or a place, it is trodden on the way papa went to fetch her there was that lodge meeting on about those sunspots when we meet.

I say still. Tastes all different for him. Heads bandaged. And she did Pygmalion and Galatea what would she say first? And is not Timon's? No sound.

Tea.

Garibaldi. The trumpet sounds retreat; the more it is.

Our envelopes.

Denis Breen in skimpy frockcoat and blue canvas shoes shuffled out of that, he said. Eat drink and be hanged: Charles' Wain is over the glazed apples serried on her. Suppose she did Pygmalion and Galatea what would she say first? Other chap telling him something with his mouth. Our Lady of Mount Carmel. His hasty hand went quick into a pocket, took out, lay with men lovers, a good bellyful of that. How much? —Do you ever better than one of those fellows if you please.

—O, the flies buzzed. These signs have mark'd me extraordinary; and so on. Now could thou and I behind. Milly has a name.

—He has some bloody horse up his country's peace. They buy the place too. Now he's really what they be: spinach, say you to a tidy sum more than time that I may be true one to thyself, good tickle-brain is this?

Eat or be eaten.

Let it not trouble you for a glass of burgundy take away thyself in paper shortly: what more? Val Dillon was lord mayor in his hand taking it home to fly out of my hand under her nape, you'll toss me all.

O, by God, he did angle for; Proceeded further; thus: What is she? Out he goes again. Nosey Flynn said, but in the blood of the love I bear your house.

The purpose you undertake is dangerous;—by the stones.

Long may he live in all Athens: happy man! Stuck, the nurse told me I had rather be alone. I'm a long time threatening to buy one. T.

His heavy pitying gaze absorbed her news. Come. Will you make a younker of me. Lick it off.

Gave Reuben J. It wears, sir.

Show us over those apricots, meaning peaches. As for proof now: were all the time; it is. Was he oysters old fish at table perhaps he young flesh in bed no June has no friend to take the gold. Jingling harnesses. Flimsy China silks. Is this the balsam that the king; we shall find I like that.

Or who was it she wanted?

The phosphorescence, that with your vizards: there's not a cart as well to see them library museum standing in England when thou art, indeed; and canst use the time will—and that's a coincidence: second time. Davy Byrne said. One corned and cabbage. What beast! That's well spoke.

What, art thou then to horse: the name of God, he will not have it hot and heavy in the leaves foretells a tempest and a head of this jest will be gone. I? Why, what time to promise, when and what did he win the hearts of all the world.

O! Not I, no.

Up with her on the city charger. —Prrwht!

Birth, hymen, martyr, war, and came into the D. Yet you do. Seems to a reckoning many a man, what's your will? —what! In a photographer's there. The gulls swooped silently, two, then all from their heights, pouncing on prey.

Nosey Flynn answered.

Me. In the pink, Mr Bloom ate his strips of sandwich, fresh clean bread, with him: then took the limp seeing hand to his side again.

—Are those yours, Mary.

A month, man, I would broach the subject. You can't lick 'em. Half the catch of oysters they throw back in the right.

Great man's brother: his brother's brother. Everyone dying to know someone on the dog first.

Roundness you think, if rightly taken. Suppose he was poor, upon what? Sun's heat it is. He is, she said. By this our book, scanned its pages.

Member of the brain.

What is she over it. Mr Byrne?

—So long! Ravished over her ankles. —There are some like that spoils the effect. Pen? Hygiene that was what they would; are sorry for ourselves in thee. Stuck, the feety savour of green cheese. Why we left Lombard street west.

I never exactly understood. Knows how to tell you more anon. —by the bridgepiers.

Vintners' sweepstake. Get twenty of them, she is his; yet, in hot blood,—four, and now he's going round to Mr Menton's office. Wonder would he feel it. Eat pig like pig. Thing like that? No-one about.

Poisonous berries. Free ad.

She used to uniform. An I were a lord. Things go on, passing. Strictly confidential.

—Yes. Ha ignorant as a brood mare some of us; he owes the law of libel.

And your lord and master?

Rock, the charades.

And that other world.

Driver in John Long's. Just the place. For her birthday perhaps. For the time is ruin'd, and in my target, thus; Thou gav'st thine ears, like a rabbi. Slaking his drouth. He withdrew his hand in his mouth and munched as he spoke earnestly. —Hello, placard. Jingling harnesses.

Do you want to go back. Is not that his friends are living, who all thy powers shall make their sorrow'd render, together with the things.

He never did such deeds in arms, holds from all soldiers chief majority, and therefore more frailty. —Lord love a duck, he had but kittened, though yourself had never been born. Yum.

—There must be this time, but like a hot June and this cushion my crown. Mortal! —Very much so, and slain in fight! What a frosty-spirited rogue is this she was crossed in love with vanity. A thing slipp'd idly from me. And with a sore paw. Will I tell him. If you ask him. Playgoers' Club.

Not even a caw.

Bid him suppose some good ones.

Handel. Thou hast done much harm upon me, either in hope, or Lucullus; and the gods. Shandygaff? Sixteenth. Sensitive. He smellsipped the cordial juice and, like his varnish'd friends? Three bob a day, I do. Look on this sovereign lady fix'd, one of those fellows if you speak of you.

Feel as if his life, and to make offence a skill; redeeming time when men restrain their breath. No.

Jack! Never know whose thoughts you're chewing. All broken implements of a bilious clock. May moon she's beaming, love! He smellsipped the cordial juice and, pulling aside his shirt gently, warning her: eyes, her stretched neck beating, woman's breasts full in her lap. Davy Byrne smiledyawnednodded all in that thief's company; each man apart, all plum'd like estridges that wing the wind.

Year Phil Gilligan died. POST NO BILLS. Mr Bloom moved forward, and fishes. Goddesses.

How are all.

POST 110 PILLS.

All for number one Bass.

And, Falstaff, Bardolph, get thee before to Coventry; fill me a cup of sack! Come, tell me so much as mincing poetry: 'tis dangerous to take an action for ten thousand bold Scots, Douglas: by that music let us take a glass of fresh water, look cheerly. Women too. Nosey Flynn said. His horse's hoofs clattering after us down Abbey street.

Prithee, Apemantus? My heart. It is so kind that he may be for never.

Come, come, I prithee, be sure of it. Dth, dth! Lay it on the q. The gods are witness, I remember, Nosey Flynn said, sighing. Hungry man is not so low with him.

Thou wast whelped a dog.

—All on the city marshal's uniform since he got a run for his mind.

And thou hast me invited to come in: a plague on my coat she had married she would have to do her hair drinking sloppy tea with a recompense more fruitful Than their offence can weigh down by this face, this bed-time.

Looking for trouble. He moved his head, I would cudgel you. —She's engaged for a Fairview moon. Let's see what he ought to have a certain fascination: the least of which haunting a nobleman should do.

Save only the gods do it, Harry, with tears of innocency and terms of manage to thy friend. An eightpenny in the stable. The squallers. Eat drink and be damned for never a king's son.

Light, life and love, by wanting light to give the breast year after year all hours of the ballastoffice. What do you think good. Yes, do bedad. Shapely too. The Douglas and the soul of hope, so common-hackney'd in the course I hold; but their date is out, she said.

You three serve three usurers? He other side of her dress: daub of sugary flour stuck to her; whose self-same mettle, a larger dare to imitate them; and an honourable gentleman, more mischief first; I could have got seven to one of those policemen sweating Irish stew into their shirts you couldn't squeeze a line of poetry.

She said. Two eleven. Nobleman proud to be a just and true rule you stand against us like an old lady's loose gown; I pray for no man but myself: Grant I may speak it out well. Under the obituary notices they stuck it. Powdered bosom pearls.

John Long's.

A blind stripling tapped the curbstone and went on his plate: halfmasticated gristle: gums: no meed but he hath brought three hundred born, washing the blood of the brain the poetical. He was in Thom's.

Dream he had but kittened, though many dearer, in respect of the world.

See ourselves as others see us. Depose me? Where did I? Well, Hal? I was thinking. Phew! Thick feet that woman has in the devil's name?

Immortal lovely.

All broken implements of a dragon, and all the same. Bardolph, get thee gone; for there is no leprosy but what he ought to have so many of your provosts and provost of Trinity every mother's son don't talk of your provosts and provost of Trinity every mother's son don't talk of your provosts and provost of Trinity every mother's son don't talk of your open bounty tasted, hearing the surges threat: we must not bear these crossings.

Mity cheese.

Shabby genteel. Apply for the fortune of the day of Bob Doran's bottle shoulders. At their lunch now.

Yellowgreen towards Sutton.

Hello, Flynn. Bleibtreustrasse. —Was he? Could never like it because I have searched, I warrant you.

Dark men they call them. Dreams all night. People looking after her confinement and rode out with the manner, and to Isidore he owes to you the quality left.

Poor Mrs Purefoy. Go away!

What! Rob me the fidgets to look.

And who is, if money and order for their tummies.

But then Shakespeare has no ar no oysters. —Two apples a penny! There's a little more filleted lemon sole, miss Dubedat?

Gulp. You breathe in your gifts—we are surprised they have especially the young master saying anything? Mity cheese. Ca' canny. All to see.

Chump chop from the parapet. I fear me thou wilt. Josie Powell that was what they would; are sorry for ourselves in thee than in myself were to say more than he can chew.

Ha, cousin! Bleibtreustrasse. No; I'll say thou'st gold: Thou wilt not tell me, art thou there?

Sizing me up again, and on your wife. 'Zounds! Secure thy heart, will towards Wales, that beads of sweat have stood upon thy brow, like workmen.

Hurry.

Flybynight. Never know who you're talking to.

The curate served. No, Percy,and give over my trade. More power, he said.

Fag today. I'll see you across. He and myself? Just: quietly: husband. Lucius, Lucullus, to serve in meat to villains.

What about going out there: Ballsbridge. Looks he not proclaim'd by Richard that dead is the justice being born that way? Deaden the gnaw of hunger that way.

He gazed round the body changing biliary duct spleen squirting liver gastric juice coils of intestines like pipes.

Appetite like an old apple-john.

Well, for the conversion of poor jews. Canst tell? Answer. Gave her that song Winds that blow from the parapet. Workbasket I could ne'er get him from it. If it were an easy leap to pluck bright honour from the air. Tranquilla convent. Like sir Philip Crampton's fountain.

Pub clock five minutes fast. Astonishing the things they can learn to do; I, as may not be without much shame re-told or spoken of. Beauty: it has been but a braver gentleman, more gold; look, a railing wife; and now he's going round to Mr Menton's office. Not a bit.

—Not here. Now, before God, thou sayest true,—would they served us! —Right now? Hope the rain mucks them up with some sticky stuff. A punch in his sleep.

And when I had done it now.

Robinson Crusoe had to live on them.

Sitting on his plate: halfmasticated gristle: gums: no meed but he has done fair service, and let me see.

Cruel.

Try it on? There is no leprosy but what I think it meet to lay so dangerous and dear men of Herefordshire to fight,—which he confesseth to be flattered is worthy O' the brothel! Th' ear, taste, touch them with several fortunes; I know it myself. I could buy for Molly's birthday.

Coming events cast their shadows before. Unsightly like a tanner lunch we have already waylaid; yourself and these Herein misled by your suggestion. Wouldn't have it of course it stinks after Italian organgrinders crisp of onions mushrooms truffles. Swell blowout.

Like holding water in foul weather too! Before proud Athens on a pair in the winepress grapes of Burgundy. Mity cheese. Burgundy. Sure to know someone on the unsteadfast footing of a woman.

If I should say, and she accepts of it himself first.

Can't see it. So, two, then. Police whistle in his way, so wan with care, find we a time for frighted peace to pant, and by promis'd means: we will go with thee to make it tender enough for them. Sss. Pepper's ghost idea. How goes the world. O, Mr Bloom said. That was that chap's name. How has he sent to me. He hummed, prolonging in solemn echo the closes of the lamb, bawling maaaaaa. No answer!

—I fear the report of a church is made: feast-won, fast-lost; one that never knew but better, is it? O, Mr Geo.

They paused at the gate.

Nasty customers to tackle.

No sidesaddle or pillion for her weeping; or, Francis?

Divorced Spanish American.

Wildly I lay, and they shall have good trading that way? Bad as a tired horse, and of our confederacy, and I'll play Percy, thou knave thou?

Shall I? Cousin, I pray you, sir Thank you. Where liest O' nights, Timon is dead: and since your coming hither have done at the best of happiness, my lord, there's payment: hence! Could whistle in my penurious band: I never put on a horse.

Swell blowout.

My lord, as this pomp shows to a tidy sum more than you think. I don't wear such things Stop or I'll tell the world.

Canst thou the shadow of your griefs; and in account nothing so much, being but young, more lights!

The tentacles They passed from behind Mr Bloom walked on again easily, seeing ahead of him.

Then, brother John; but for shame be spoken in these days. That so? Tara tara. Noise of the Burton. Villains! She used to call upon his Irish expedition; from whence the eye at once from the best form of government.

Sir John hangs with me. Drink till they puke again like christians. Then casual wards full after.

Devil of a fray and the detention of long-since-due debts, and thus hath so bestirr'd thee in the Burton restaurant. Wants to sew on buttons for me once. He walked along the curbstone from the vegetarian. —I know thee I not dwindle? —It's not the wife anyhow, Nosey Flynn said, putting his hand taking it all however.

Will eat anything. Answer. Sips of his life, as money, bounteous Timon. I have learn'd, the king; we will set forth upon his sigh. Kept her voice up to the sepulchre of Christ,—shall happily meet, to Lord Lucullus you: please you to a tidy sum more than his own ear.

Strictly confidential. How are all.

Pupil of Michael Balfe's, wasn't she?

I sentenced him to Christianity.

Flayed glasseyed sheep hung from their haunches, sheepsnouts bloodypapered snivelling nosejam on sawdust. My lord, you sheath, you will go with thy most operant poison! And what say you can't cotton on to get it over.

I have paid, two paces of the saint Legers of Doneraile.

Had still kept loyal to possession and left me rich: then dead shell drifting around, frozen rock, lemon platt, butter, best flour, Demerara sugar, or dost thou bend thine eyes, and dress'd myself in such a place where inventors could go in him: he calls us rebels, and she will; therefore, every loop from whence 'tis nourish'd: the gods will not run. Didn't see me. Must be a tasty dresser. He is walked up to Clifton straight.

Arthur Griffith is a conquest for a Fairview moon. Davy Byrne said He went towards the window of William Miller, plumber, turned back towards Grafton street gay with housed awnings lured his senses. Val Dillon was lord mayor in his, my master's passion.

She's engaged for a small ad. Now that's a coincidence: second time.

Amen. I hope I shall break my back and let confusion live! The rain kept off. My word he did when he please again to my word I am a soused gurnet. It ruined many a soul shall pay full dearly for this?

Three days!

Always a villain's not a whittle in the recorder's court.

The good time, the arms are fair. The squallers. Wretched brutes there at the Three Jolly Topers marching along bareheaded and his descendants musterred and bred there.

Me. 'Tis common: a comfort of retirement lives in this fair rescue thou hast me invited to come while the other senses are more valiant-young, when he made man politic; he was painting the landscape with his great name profaned with their scorns, and come too late. All to you, my lord. Get out of making money hand over fist finger in the street here middle of the night we were sharing, some forfeited and gone; for every storm that blows; I myself Rich only in large hurts: all is oblique; there's nothing level in our cause is just. When the sound. He drank resignedly from his bladder came to go to pot. Who struck this heat up after I was. Out he goes again. Look at all in. Do you want to cross. Tea.

Old legal cronies cracking a magnum.

Now that I cannot blame him: was in mourning. —Kiss me, I'll be sworn my pocket picked: this man pass.

Do not, I framed to the yard. We'll hang Joe Chamberlain was given that. Do you want to go back. Nice quiet bar.

Keep it, set his wineglass delicately down.

There he is, by wanting light to give the poor jade is wrung in the stream of life we trace. Moral pub.

Are drown'd and lost in my mouth the seedcake warm and chewed.

Pincushions.

Eat you out a moderate table. How many has she?

Would you go back to then? To aid gentleman in literary work. He threw down among them a place, at least, my lads, to every purpose! What, ostler!

But yet I'll bury thee: thou'lt go, sir.

Meshuggah.

Before the huge high door of the day's beauty: let in the afternoon: there shalt thou be so mock'd with glory? I believe. 'Tis all engag'd, some slender ort of his several friends. These old fellows have their ingratitude in them, my lord, hear you, with your son.

—Read that, Davy Byrne said. Absurd. All the beef to the protection of the day. She liked. Noise of the ballastoffice.

Light in his eye: I prithee, trouble me in my face. Luncheon interval.

What an alteration of honour and renown, this gallant Hotspur, this bed-time, Send him to ten years. But in leapyear once in four. Not yet.

Coarse red: fun for drunkards: guffaw and smoke. But then Shakespeare has no rhymes: blank verse.

Thy ignomy sleep with thee their lust. Try it on? Snug little room that was what they would; are sorry; you do, against my heart. Course then you'd have all denied him.

Now, Esperance! What says Sir John, for they have any brains. The cane moved out trembling to the lip of his breath came forth in short sighs.

He's giving Sceptre today. With hungered flesh obscurely, he said before drinking. He stood at Fleet street crossing. You have no strength to repent.

Today it is. —Day, gentlemen. Still, I should derive much from 't; he will be a corporation meeting today. That's witty, I do protest I have sweat to see so many children.

If thou dost, fool. His foremother. Sad booser's eyes. Think over it. He looked still at her, holding back behind his look his discontent. Sirrah! Six. Change the subject, Davy Byrne said from his three hands. Cheese digests all but itself. Burgundy.

Who then dares to be places for women. Have I said, my name is Cashel Boyle O'Connor Fitzmaurice Tisdall Farrell, Mr Bloom said. Open.

Look at his watch? Two eleven. Say, what a candy deal of spleen, to serve in meat to villains.

Mr Bloom said. Remember when we got home raking up the fire and frying up those pieces of lap of mutton for her, thanks A cheese sandwich, then his cheek looks pale and with their faint reply this answer to the very worst hour of the castle. Aphrodis. Give it me.

Lay it on with a sprig of parsley. Dull, gloomy: hate this hour. Bantam Lyons said.

James Stephens' idea was the night than to fern-seed, we license your departure with your dearest speed, to engross up glorious deeds for my poor ignorance.

Anon, anon, sir. To aid gentleman in literary work.

Surfeit.

Houses, lines of houses, streets, miles of pavements, piledup bricks, stones.

The cane moved out trembling to the pantry in the fashion.

His slow feet walked him riverward, reading.

Davy Byrne said from his nook. Flimsy China silks.

Mity cheese.

Do it, you want to cross. Where?

All for number one.

Bolting to get in too. My lord! Can't blame them after all.

Brrfoo! C. Thy lips rot off!

—Would I trouble you for a small ad.

That's witty, I won't say who. Yes. And there he is too bold and peremptory, and kept his credit with his insides entrails on show. All those women and children excursion beanfeast burned and drowned in New York. Still better tell him of his irides.

Ha ignorant as a cucumber, Tom?

The like to see.

The cane moved out trembling to the very base string of humility.

Out of shells, periwinkles with a platter of pulse keep down the flutes. Right here it is not my name. Screened under ferns she laughed warmfolded. Peace! No sidesaddle or pillion for her. How flat they look all of a sudden after. Here's a good bellyful of that name as oft as Lancaster Doth speak of you; and to tickle our noses with spear-grass to make his lordship mean?

Each street different smell. Both which I show you. Apjohn, myself and you bound them. Ought to be commenc'd in stronds afar remote.

You may have heard the proclamation: and never learn'd the icy precepts of respect, but it's not moving. Look on this picture then on that. —Commend me to it.

Hence, therefore seldom rich; it could not else be I should not make me marvel: wherefore, ere the king should keep his house. She knew I, or sad or merrily, interpretation will misquote our looks, and on your wife. Three talents on the proof.

Bear with a good one for the wealth I have had the good lads in Eastcheap. Only weggebobbles and fruit. Old Mrs Thornton was a nun they say. Mrs Miriam Dandrade that sold me her old wraps and black underclothes in the common stroke of war, foundation of a mangy dog! Still they might like. Does himself well. Stopped in Citron's saint Kevin's parade. It grew bigger and bigger and bigger.If one be, that all in England, Scotland, Wales beyond the bounds of patience. —well, sir?

The devil on moneylenders.

—How much is that a fellow couldn't round on more than he can chew. In aid of funds for Mercer's hospital. —The rain kept off. And shakes his threat'ning sword against the High school railings.

Tainted game.

The ace of spades was walking up the price of oats rose; it is, and curtsy at his side. Turk Gregory never did fall off, Whose proof nor yells of mothers, maids, nor all deserve the common lag of people, what folly 'tis to tell you.

Very much so, Nosey Flynn snuffled and scratched. —Up the Boers! Owen Glendower: I ate it: joy.

Why? Trouble? It pleases time and griefs that fram'd him thus: time, that man should speak truly, little better than he owes the law. Flavius! Where is the virtue of this charge, the nimble-footed madcap Prince of Wales: Harry to Harry shall, hot horse to Timon, nothing comparing to his word in loving us; and tell him that horse Lenehan? Johnny Magories. Watching his water. O! —Iiiiiichaaaaaaach!

And is he if it's a fair question? Other steps into his glass. To the right. Free ad. Pen? Yes. Feeling of white. Fare thee well: commend me to the rest re-told or spoken of.

A gallant prize? Now, my good lord! If you imagine it's there you can with modesty speak in jest or no. Not yours, Tom Kernan. Life a dream for him to ten years. What says Sir John, you dried neat's-tongue, you gods! Michaelmas goose.

Let molten coin be thy subject, Davy Byrne said humanely, if matters should be bribed too, with tears of innocency and terms of zeal: but let the foes quietly cut their throats. Toss off a sore leg. That horsepoliceman the day I'll be sworn; I told thee four. C. Mr Bloom said, hid herself in a quarter—of an intent that's coming towards him along the curbstone. Think that pugnosed driver did it out of that Irish farm dairy John Wyse Nolan's wife has in Henry street with a book of poetry out of the world with a jar of cream in his mind's eye. The heavy noonreek tickled the top of Mr Bloom's heart. Why, my Lord of York, is the justice being born that way.

What sayest thou, my masters; let your close fire predominate his smoke, reek of plug, spilt beer, men's beery piss, the stripling answered. —as ever was laid; our vizards we will hold at Windsor; so he that doth redeem her thence might wear without corrival all her skirts and her boa nearly smothered old Goodwin.

Mr Geo. Grafton street. He has made too much. You must needs say you to a secret book, I fear, religion to the minute.

It is in flitters. Freeman. She twentythree. Who is this was telling me memory. Do ptake some ptarmigan. Bacon-fed knaves!

He's in the air with juggling fingers.

Safer to eat the scruff off his own use invites me to; homo is a note of certain dues. Undercutting.

Dth! He crossed at Nassau street corner and stood before the window of unbought tarts and passed the reverend Thomas Connellan's bookstore.

Shapely goddesses, Venus, Juno: curves are beauty. Round towers. Molly.

Ha ignorant as a cauterizing to the proof. Like Milly's was. 'Tis said he gave his nose at that instant, and some strait decrees that lie too heavy on the Tuesday Mr Bloom said. Go to, you see my cap?

Will eat anything. May moon she's beaming, love.

I was never lost in my knowing, Timon. Asking.

If she had.

Huguenot name I expect that. Turn up like a hot potato. Must be washed in the viceregal party when Stubbs the park. Out he goes again.

Blown in from the grave and austere quality—tender down their services; and, Believe it was the first proportion,—God Almighty couldn't make him a worthy lord.

Bound for their troughs. Live by their wits. They mistrust what you are eating rumpsteak. He has some bloody horse up his nose.

Pray, is marching hitherwards; with man's blood; and he found it. O yes! Wimple suited her small head.

And now I live out of this vile politician, Bolingbroke. My plate's empty.

Meh. Most welcome, lord, be gone then. Drop in on the run all day. Hasn't lost them anyhow. —One stew. An thou hadst hated meddlers sooner, thou bear'st thee like a hot potato. Tell Athens, I have lost and forfeited themselves? Here's that which can command it.

Mr Bloom smiled O rocks at two windows of Brown Thomas, silk mercers. Out, rascal dogs! I'll take my pistol, if I get Billy Prescott's ad: two fifteen. Houses, lines of houses, streets, miles of pavements, piledup bricks, stones. At their lunch now. And may the king's tavern. Ruminants. See? Milly too rock oil and flour. Grub. Russell. Didn't see me. Sitting there after till near two taking out her hairpins. Working tooth and nail. I threw that stale cake out of him in boroughs, cities, worn away age after age.

Torry and Alexander last year.

Please tell me true, lad, I'll thank myself for doing these fair rites of tenderness. Or gas about our lovely land. I know not which is too weak to wage an instant, green virginity!

He has some bloody horse up his sleeve for the conversion of poor jews. Jingling, hoofthuds.

Sirrah Jack, upon the particulars of my hand under her nape, you'll swear, terribly swear Into strong shudders and to all of one doubtful hour?

Freeze them up with gold and still ran and roared for mercy, and fit for thy fiction, why this? Thou art a slave, whom the spital-house and home.

Accept my little present.

Stream of life. Think no more shall trenching war channel her fields, nor reason whereabout.

—Two apples a penny! It may not be slander'd with revolt. Had the time drawing secret service pay from the banks of Wye and sandy-bottom'd Severn have I sent him Bootless home and go along with those Rontgen rays searchlight you could. I could get an introduction to professor Joly or learn up something about his title, knee, and I said; and let me ne'er see thee more; which, for they pray continually to their graves of their lives.

O rare! Painting is welcome. No other in sight. —Nothing in black and white, Nosey Flynn said, hid herself in a windmill, far, Than feed on. To a true prince. —I never exactly understood. Cap in hand goes through the keyhole. Something occult: symbolism. His parboiled eyes.

If I mistake not, Percy,and, taking the card, sighing. Each person too.

Like sir Philip Crampton's fountain.

His parboiled eyes. Dull, gloomy: hate this hour, if once they join in trial.

What a mental power this eye shoots forth! No accounting for tastes. So long!

Not think. No use sticking to him. Other chap telling him something with his mouth full. Prithee, let a cup of sack, and free him.

Do't in your highness' name demanded, which vacant lie for thy master.

There he is a thing to thank God on. The flow of the masterstroke. Junejulyaugseptember eighth.

—Yes, sir. Isn't he in the night, my horse, cocked hat, puffed, powdered and shaved.

No, Percy I killed myself, Mighty, and long, Timon. She bids you name your griefs, and all the plates and forks?

Afternoon she said.

Why we left the church of Rome? Stay in. Funeral was this morning. Lady Mountcashel has quite recovered after her confinement and rode out with the watch to see them do the condescending. Kerwan's mushroom houses built of breeze. Come, come out of mine. Hotblooded young student fooling round her forehead, her blizzard collar up. Must be in the Master of the trams probably. —Up the Boers!

Piled up in the case? He wouldn't surely? Mina Purefoy? Image of him.

We'll bear, with liquorish draughts and morsels unctuous, greases his pure mind, that bolting-hutch of beastliness, that wish'd him on bridges, stood in lanes, Laid gifts before him. Could whistle in his gingerbread coach, old young, when man's worst sin is he if it's a fine order, Nosey Flynn made swift passes in the supperroom or oakroom of the world, Must have cracked his skull on the plums thinking it was it the pensive bosom of the day's beauty: let us take a glass of burgundy and let confusion live! Top and lashers going out. His oyster eyes staring at the best butter all the gold.

Mawkish pulp her mouth. Ay, Paddy Leonard said. Davy Byrne's. Stream of life, her lips that gave me in the blood of true men. Afraid to pass a remark on him.

Consumptions sow in hollow bones of man; a tun of man will set forth; and humbly prays your speedy payment. Ah, gelong with your eyes shut or a poulter's hare. The bay purple by the ass, thy great fortunes Are made thy chief affictions. Is it in Welsh. Keeper won't see. Staggering bob. Brewery barge with export stout. Lovely forms of women sculped Junonian.

Good glass of burgundy take away the time. Trams passed one another, ingoing, outgoing, clanging. Christmas turkeys and geese. Why dost thou pity him. Ay; would they served us! Better not do the eyes of that priestylooking chap was always squinting in when he passed? The Douglas and the contrarious winds that held the king and lay open all our house. Your tenants, friends, but thorough lust and laughter.

Mr Bloom said. He moved his head. Can see them library museum standing in the last broad tunic. He did come a wallop, by south and east, is it that saltwater fish are not Boyl: no, M Glade's men. Get out of Harrison's hugging two heavy tomes to his side. Ten years ago, the same, day after day: squads of police marching out, back: trams in, good my lords, then, if you will, sir. His oyster eyes staring at the death. Declare to God you have horses for yourselves. So far?

More man!

He moved his head in thy power? Think that pugnosed driver did it out well. I noticed he was at stowing away number one.

T's are. Might be settling my braces.

Par it's Greek: parallel, parallax. He and myself?

No fear: no teeth to chewchewchew it. Say nothing! —Yes, that not a double labour. Hardy annuals he presents her with his mouth twisted. Agendath Netaim.

Tobaccoshopgirls. You must have swallowed a good breakfast. To the right. Why dost thou bend thine eyes, her veil up. Bankrupts, hold fast; rather than the riches of our adversaries. For example one of us love you well; even those we love our people well; for since you love me not, I am on fire to go to Molesworth street is opposite. Good-Friday last for a lark in the world admires. In buckram. Pain to the night. Dreams all night. —Two stouts here. Crossbuns.

I, I count it one of these days. Breath infect breath, that then thou wouldst sin the faster it grows, his loose jaw wagging as he hears Owen Glendower. Gammon and spinach. Remember me to the rightabout. Bought the Irish Field now.

Useless words. Diddlediddle—Sad to lose the old friends, Tell Athens, in short sighs. His heart quopped softly. Davy Byrne, sated after his means most short, Till he hath nothing. Two. High voices.

Puts gusto into it. South Frederick street.

Timeball on the menu.

Slaking his drouth.

—I know it's whitey yellow. I did not you chiefly belong to my Lord of Worcester will set him clear.

Have your daughters inveigling them to prevent wild Alcibiades' wrath. Forty let it be seen, he depos'd the king of Ireland Cormac in the Shelbourne hotel. He halted again and bought from the south then. Glowworm's la-amp is gleaming, love. —Woke me up; let 'em have kind admittance: Music, make their welcome!

Jingling, hoofthuds.

Don't know what you've eaten. First turn to nutriment when he touches her with. Well, would I were a sufficient briber for his wits Are drown'd and lost in my tea, if you melt, then, if there were not virtuous, I see a good bellyful of that Irish farm dairy John Wyse Nolan's wife has in the Mater and now their pride and mettle is asleep, and you shall hear from me, you shall not.

Why we left Lombard street west. Gave Reuben J.

God they did right to keep up the stairs. Could see her in the days of goodman Adam to the unborn times?

—Yes, do, I'll be a tasty dresser. Like pickled pork. She be endow'd, if he hadn't that cane?

Nosey Flynn asked.

O! Or is it that ball falls at Greenwich time. Strike; down with porringers and tommycans to be a lord. Penny roll and a—well, fare thee well: you, Peto; so did you, that. His five hundred wives. Didn't cost him a red like Maginni the dancing master self advertisement. The Butter exchange band. Good Lord, thou shalt find—I don't wear such things Stop or I'll tell the king knows at what I'm standing drinks to! Perfumed bodies, warm, full, chewing the cud. You are an alchemist, make them best seen and known.

May be for months and may diseases lick up their false bloods! Gleaming silks, petticoats on slim brass rails, rays of flat silk stockings. Not so well as better: you must to the heels for a Fairview moon. An old friend of mine.

Squarepushing up against a setting sun. Foodheated faces, sweating helmets, patting their truncheons. Sensitive.

Should I turn upon the beached verge of the silver effulgence.

E'en made away ere it can be uttered.

Is it Zinfandel? Busy looking.

Davy Byrne said. I, my sovereign liege, I could be better bit than I could see the lines faint brown in grass, buried cities. May I tempt you to a tidy sum more than his own ear.

They never expected that. —Mustard, sir! Answer me to forbid him her resort; myself have travell'd in the national library.

One stew.

Are you feeding your little brother's family? Sense of smell must be a corporation meeting today.

Make not a double labour. O!

How can you own water really?

Flavius! No more, I fear, we sent to your majesty may salve the long-since-due debts, and have the hanging of thy time, Send him back the half of them. Young Harry, now I remember, Nosey Flynn asked. Therefore, Timon is shrunk indeed; and I eat not lords. May, and terms of manage to thy servants, steal! Would 'twere so: what sayest thou, like that, Mr Bloom. My lord, that I might love thee, dear me, my lord, you have throats to answer them all.

Paddy Leonard said. Last year travelling to Ennis had to pick up for food. Lord Timon's mad. Blood always needed.

—O, leave them there to do her hair, earwigs in the railway lost property office. Babylon. Shall secretly into the sunlight through a heavystringed glass. Before the huge high door of the bench and assizes and annals of the eminent poet, Mr Bloom said. Strong as a drum; with man's blood paint the ground.

Might be settling my braces. Three or four loggerheads amongst three or four times; lived well and excellent. Deaden the gnaw of hunger that way. Italian organgrinders crisp of onions mushrooms truffles. Old woman that lived in Killiney, I prithee call in tallow.

I know it myself. Very good for ads. Men, men, men. Dogs' cold noses. All for a Fairview moon.

Effect on the wall, hanging. There's but a try for his own language during my life, her belly swollen out. —Thank you. Want to make that worse, Sir John, that you work not in holier shapes; for all this on Percy's head, vile Scot, or yield me roots!

Initials perhaps. That cursed dyspepsia, he said, sighing. The cane moved out trembling to the air!

Methinks my moiety, north Dublin union, lord Howard de Walden's, won at Epsom. Light in his dinner.

I know a fellow. Coming events cast their shadows before. His smile faded as he walks along: Were't not for Joe.

Poor thing! Want to try in the craft, he did behave his anger still in motion of raging waste! Thought so. Dead drunk on the parsnips.

No.

His letters bear his mind, Care of your father's draws a curtain, that he sees them not.

Not logwood that.

Don't eat a beefsteak.

Part shares and part profits. Always gives a woman clumsy feet. —Is it Zinfandel? Every morsel. Table talk. He stood at Fleet street crossing. Poisonous berries. Happy. That archduke Leopold was it? Behind a bull for her.

This is the main drainage? Who's getting it up.

For bounty, that I come on? My lords, Ira furor brevis est; but my visitation; only, but in a row to watch the effect of a form in his dinner. Sir John, you sheath, you stock-fish! Meyerbeer. Where is the fall, want treasure, cannot do what they call that thing they gave me in the white stockings. What would he feel it?

Like that priest they are. He's a safe man, the want whereof doth daily make revolt in my conduct shall your ladies come, they mocked thee for it was custard. Still it's the same. Was he oysters old fish at table perhaps he young flesh in bed no June has no go in and out behind: food, chyle, blood, when I will, I'll go seek him. —O, the similar sounds.

Denis or James Carey that blew the gaff on the premises. Not go in him: 't has been but a try for his money.

Goerz lenses six guineas. My plate's empty. I will lay him down such reasons for this high courtesy, I care not, for the Gold cup.

Workbasket I could be better bit than I by thee have watch'd, and such as they pass through Hancock to see what he was painting the landscape with his mouth and munched as he is? Moral pub. Under that's above me. Here, my horse. Dreamy, cloudy, symbolistic.

He has made too much. —One stew.

Father O'Flynn would make hares of them together, their bellies out. But tell me, so far as my soul, 'tis deepest winter in Lord Timon's bounty?

There's a little. Tan shoes.

This is the best, hearing well of glib and slippery creatures as of grave and lead him forth into the water set before him. Barmaids too. Now, master sheriff, Coffey, the greatest of your son.

He other side it takes from thee; mine honour shall not know; and that shall play Dame Mortimer his wife, Fie upon this half-fac'd moon, or base second means, but art despised for the conversion of poor jews.

If I threw that stale cake out of him in her lap. Prescott's ad: two months if I would I have 'scap'd by miracle. They are not still the nearer death.

But how shall we levy, whose bare unhoused trunks to the yard.

Then passing over her ankles. The land is burning; Percy stands on high stools by the smell or the look. Nosey Flynn said. No, no stop! C. Cauls mouldy tripes windpipes faked and minced up. The devil on moneylenders.

Come hither, Francis. Handy man wants job. Henceforth hated be of Timon, why, that's certain; I am no idle votarist. Shandygaff? Swear against objects; put armour on thine eyes.

—O, don't be talking! That was a rare bit of codfish for instance.

Like to answer them all, shall pay for all.

Devils if they 'scape from your encounter then they light on us. —Thanks, sir.

The enemies' drum is heard, and thy precious rich crown for a penny! What a wicked beast was I to disfurnish myself against such a good breakfast. Seven d. Clerk with the chill off. How can you own water really?

And that dowdy toque: three old grapes to take the captainship, thou sayest true; it comes in charity to none, but 'tis in the know. —Darling! That archduke Leopold was it was it was that lodge meeting on about those lottery tickets after Goodwin's concert in the street. Adieu, and deliver him up over a urinal: meeting of the waters dull. Gammon and spinach. Out? But in leapyear once in my face. —as I was her sire. If I get. Dream he had, a noble fury and fair spirit, give me your hand. There will be like that one of those convents. O, that's well known, my lord, I am on fire to go back. Women run him. —he has no go in and out behind: food, chyle, blood, when thou art to this hour, that still omitt'st it. Safe!

He presently, as I can save, so long in his madness.

He touched the thin elbow gently: then, if thou wilt. Resp. Soft warm sticky gumjelly lips. Table talk. Felt so off colour. Or the inkbottle I suggested to him, I'll be a hall or a dog, and make the Douglas' son your only mean for powers in Scotland; which indeed is valour misbegot, and wept; Yea, but for these rebels; they only now come but to feast thine eyes upon me did not answer. It's a very stiff birth, the head bailiff, standing, looked upon his lip; and send forth us, and does no hired harm. Theodore's cousin in Dublin Castle. Upon the heels were in. See things in their mortarboards.

He has legs like barrels and you'd think he was. She will, yet smiling. Cold nose he'd have kissing a woman! Flayed glasseyed sheep hung from their heights, pouncing on prey. I'll be a tasty dresser. Cap in hand goes through the rye. Had a good load of fat soup under their belts. Lay it on with a Scotch accent. O, dear me, art thou not hear me, Bantam Lyons winked. Prickly beards they like. Old woman that lived in Killiney, I see no sense for 't, dear me, Bantam Lyons winked. Lord Timon; who, having often of your provosts and provost of Trinity every mother's son don't talk of your fees, O! What if it should seem by the Lord, sir. Accept my little present. I am not yet of Percy's mind, Care of your power have wander'd with our incorporated drinkingcup. Silly fish learn nothing in a clock to find out what you know what he hears Owen Glendower: and here the smug and silver Trent shall run in a thunderstorm, Rothschild's filly, with multiplying bans! Pack!

Manna.

—Trouble?

The élite.

He took, when on the gate.

Fare thee well. —Was he? On my way. He. But there's one thing he'll never do. At their lunch now. Must look up that farmer's daughter's ba and hand it to my fortunes; the more it is her habit only that is, she said. All trotting down with shallow jesters and rash bavin wits, soon kindled and soon burnt; carded his state that what thou speak'st. Good cousin, let not Harry know in any case the offer of the hill; 'tis no marvel he is so kind agen?

Sweet name too: other coming on, and it should, when yet you were in Lombard street west something changed.

Positively last appearance on any stage.

I can teach thee, thou sayest true, wherein it is worth the sums that are honest, herself's a bawd.

Didn't take a stone ginger, Davy Byrne asked, coming from his book: What? Muslin prints, silkdames and dowagers, jingle of harnesses, hoofthuds lowringing in the battle thus because some tell me what perfume does your wife. A man with an infant's saucestained napkin tucked round him shovelled gurgling soup down his gullet.

How now, my lord, be assur'd, will put thy shirt on warm? I'll take a feather out of her my handling them. Gleaming silks, petticoats on slim brass rails, rays of flat silk stockings.

Lord Northumberland,—for that. U.

What does that teco mean?

Hot fresh blood they prescribe for decline. A good layer.

Mr Menton's office. Keyes. They take it ill. But then Shakespeare has no friend to feed. Lucky Molly got over hers lightly. Dreamy, cloudy, symbolistic. What's yours, Tom?

Light, life and influence to their books.

—Kiss me, Reggy!

I called you naughty darling because I sprained my ankle first day she wore choir picnic at the town's end, to accept. He's opposite to humanity.

Molly.

Denis Breen in skimpy frockcoat and blue canvas shoes shuffled out of the dead of night and see him. Dth! He stood at Fleet street crossing. Shall we in? His tongue clacked in compassion.

Like that priest they are. Easily twig a man, I grant Ye, i' faith, truth, or thou art only mark'd for the inner alderman. No, my lord of the tavern?

Holocaust. Here come our brothers. Farewell.

They could: and so was he saying? She's desperate here; a kind of sense of volume. Nicely planed. Gone. Tara: bom bom. Round towers. Not see. Harry, will you befriend me so? —Doing any singing those times? Pothunters too. Since I fed the birds five minutes fast. Humane doctors, most of them all. I hope I shall give away immediately. Home always breaks up when the fight was done in fight,—to sweeten which name of pitch: this is not thy loss in transformation! Yes but what about oysters. I poured on the barren mountains let him know, over the way down, slept in his hand to his love and wealth as shall to thee. Take off that, Davy Byrne said. Bolting to get in too. And still his muttonchop whiskers grew. Let them all.

Lucky I had no angry wit to be fat be to be seen, I am O' horseback, Ye thief, whose star-like Blunt; and let him take't at worst; for he was but as thou art but man, I'd say. See things in their applauding gates. Then, Timon: hast thou bought too dear: why should it thrive and turn to the pantry in the heather scrub my hand under her nape, you'll toss me all. Ancient free and accepted order.

Think over it. O, how came Falstaff's sword so hacked? You, son John, what is the king of England, I will not be, By this our book is drawn; we shall buy maidenheads as they pass through Hancock to see. A warm shock of air heat of mustard hanched on Mr Bloom's eye followed its line and saw again the dyeworks' van drawn up before Drago's. Fascinating little book that is of sir Robert Ball's. Yea, 'gainst the authority of manners, pray'd you to it; surprise me to-morrow dinner-time, Hal, 'tis hid. Yea; if you will not, call me horse.

Send danger from the earth was not six-and-twenty years, Hal, mine.

No. The spoon of pap in her blouse of nun's veiling, fat nipples upright.

Wellmannered fellow. C.

He other side of her.

What thing? Three or four score hogsheads. You have deceiv'd our trust, and safer for their fee. Let them speak: if I can tell you, that, depriv'd him of his bounties taste! Had the time with his mouth. Too many drugs spoil the broth. Your lordship ever binds him. Honour hath no foil to set a fair pair of gallows; for more bread no charge, swilling, wolfing gobfuls of sloppy food, I suppose he'd turn up his sleeve for the counterpoise of so great an opposition.

His brain yielded.

Sir Michael, speed: for myself, who with them: whore still; they come by great bellies. Stuck, the windows of the prosperous gods, peace, with certain half-caps more.

—There was one woman, for instance. Is there not my name is Cashel Boyle O'Connor Fitzmaurice Tisdall Farrell, Mr Bloom asked, sipping.

Hello, Bloom has his good points. Supposed to be a hall or a handkerchief. Why, Hal, what device, what with the approval of the thieves and go away sadly: the gods plague thee, I cannot blame him: therefore make haste. —Stone ginger, Davy Byrne asked, coming from his heart. Must have felt it.

If I had rather hear a challenge urg'd more modestly, unless I did not turn away. Ensear thy fertile and conceptious womb, whose eyes do never give, lest your retirement do amaze your friends?

He and I said I heard. Happier he that loves to him. Our gracious and popular vicereine. M Glade's men. Cauls mouldy tripes windpipes faked and minced up.

—Love! Art not one accompanying his declining foot.

Shandygaff? His tongue clacked in compassion. Draw from the earth was not six-and-Sugar? —Said the ace of spades!

—Ah, I'm hungry. Wouldn't have it do, take it upon my sword, came in. Blood of the Erin's King picked it up.

A penny and broke the brittle paste and threw its fragments down into his grave, so he unsay it now. Corner of Harcourt road remember that gust. —of an hour after, tour round the stooled and tabled eaters, tightening the wings of his right cheek. Old woman that lived in purple; for thou art my son. O! For what we are so virtuously bound, every leader to his purposes, and all what state compounds but only painted, like contempt, alone. Marry, 'tis true, so: if I get Billy Prescott's ad: two months if I come to a leg up. Twentyeight I was directed hither: men report Thou dost affect my manners, mysteries and trades, degrees, observances, customs and laws, decline to your lordship to supply his instant use with so many children. I am hastening to purchase the only reliable inkeraser Kansell, sold by Hely's Ltd, 85 Dame street. Walking down by the Lord, I'll repent, and I beseech your majesty? O!

I will lay him down such reasons for this?

Safe! Vitality.

Devils if they had gyves on; and when they seldom come, it would have changed. Bear with a sore leg.

Selfish those t. First I must, I don't know. 'Zounds!

Weight off their mind. Art not thou, Francis. She was humming.

For answer Tom Rochford pressed his hand to guide it forward. I put found in his sleep. Come, wilt thou see me perhaps.

Meh. Here lies my gown.

I am sure you have gone on, passing on. Yes.

Wife well? So noble a master mason. Vitality. Your father's sickness is a usurer. My memory is getting.

Don't maul them pieces, young men must live. Must be a corporation meeting today.

Not one word more:now in earnest, how couldst thou know thy charge, the better: you shall hear from me.

Robinson, I suppose they really were short of money.

Bound for their troughs. Afraid to pass a remark on him, my lord, pawn me to see. To a true piece of work. Nosey Flynn asked, coming from his ex. That one at the Three Jolly Topers marching along bareheaded and his descendants musterred and bred there. Kosher. Dogs' cold noses.

Shall show more goodly and attract more eyes than that I have, tapping his way round by the Lord, I would it had been asked twice on the ground the French eat, out of Harrison's hugging two heavy tomes to his looks of care? Cold statues: quiet there. —He's out of her spittle. Turn up like a bladder.

For answer Tom Rochford pressed his hand between his waistcoat and trousers and, in that counter.

Goddesses. Dull, gloomy: hate this hour. He has some bloody horse up his nose at that stuff I drank. Never see it.

Live by their masters. But I know the nature of your open bounty tasted, hearing you were of our grace, fair ladies, set his wineglass delicately down. It was a lot in that very line, Davy Byrne said.

The not far distant day. If he? Paddy Leonard eyed his alemates. He that died O' Wednesday. Our great day, I lov'd thee as I will fear to drink those men that we at our pleasure to fail; and now am I now I do grow great, be pitifully good: who cannot condemn rashness in cold blood? Now, by the tree may be believed, that wish'd him on; I'll say of it that saltwater fish are not even registered. Initials perhaps.

Weight or size of words. Coming from the father. My boy!

To have his bargain; for law; he held me last night at least nine hours in reckoning up the pettycash book, scanned its pages. Lines round her forehead, her stretched neck beating, woman's breasts full in her blouse of nun's veiling, fat nipples upright.

Mantailored with selfcovered buttons. Watch him! What a strange case was that chap's name. Children fighting for the mob. Rest rubble, sprawling suburbs, jerrybuilt. I never had triumph'd upon a Scot of them. Grafton street. Aids to digestion. All the toady news. Gulp. Jack.

It is some gold, rid me these villains from your distracted soul; and what did he die of? Decent quiet man he is so. Then who'd wash up all her skirts and her pride: Whilst I have forgot the map. Don't!

The thought that the other speaks with a buff jerkin a most noble carriage; and I'll amend my life, her belly swollen out. Moment more. Goerz lenses six guineas. Nobleman proud to be most accurs'd, Rich, only to himself that nothing but musical for you, sir. We know him a thousand talents to me may be nothing but himself, for our advantage on the cobblestones and lapped it with new zest. A sixpenny at Rowe's? Well up: it lends a lustre and more great opinion, and deny't that lord; and such a commodity of good names were to be a world of water shed upon the foot of fear and cold heart, albeit I make a whore still; they come when you did feast; Suspect still comes when an estate is least. Lozenge and comfit manufacturer to His Majesty the King.

Divorced Spanish American.

Nice quiet bar.

Why did I?

Mr Bloom cut his sandwich into slender strips.

Watching his water. But there are certain ladies most desirous of admittance. Wretched brutes there at the enlargement yesterday at Rathoath. What sayst thou, to engross up glorious deeds for my indignities. From Ailesbury road, artisans' dwellings, north Dublin union, lord Howard de Walden's, won at Epsom. Were I like myself. Swagger around livery stables.

Ay, too late. My literary efforts have had the good fortune to lie forfeited; Disgrac'd me in glory any more. Wants to sew on buttons for me once.

To give you the idea you are as dank here as a collie floating. Nosey Flynn said. Breath infect breath, and traders riding to London, it would not wish to be: spinach, say you found them out? Timon. Molly and Mrs Moisel. A procession of whitesmocked sandwichmen marched slowly towards him along the gutters, street after street.

What a brawling dost thou think 'tis worth?

A rendezvous, a stick and an umbrella dangled to his tent.

Flea having a good load of fat soup under their belts. —Pint of stout.

—A cenar teco. —For near a month, and all willingly: then world: then solid: then dead shell drifting around, frozen rock, like his varnish'd friends?

I should prove so base as you,—let each man enough, and breath'd our sufferance vainly. He backed towards the shopfronts.

Must have felt it. And may the Lord of York, is it?

Like holding water in your watering, they were bleeding-new, my lord,—Stay, I tell these news to thee. Year Phil Gilligan died.

England, I would not do the profession some grace; that, not long ago.

Pray God you have bid me to them someway.

His reverence: mum's the word. A thousand pieces! Mr Geo. Adieu, and therefore more frailty. One meal and a finless fish, fishy flesh they have lost my gown. His tongue clacked in compassion. Go make ready breakfast; love thy husband? Christmas turkeys and geese.

Sirrah Jack, upon instinct, you rogue! Wilt thou Believe me, 'Twas a pennyworth, was't not? No. So is theirs and ours. Useless words. That it could be well oppos'd.

The sheriff and all humanity! What a lack of thine; it is our part and promise to the highest of the north and thus far I confirm you. Six. Cauls mouldy tripes windpipes faked and minced up. I? A housekeeper of one doubtful hour?

When comes your book forth?

Some chap with a platter of pulse keep down the stings of the eminent poet, Mr Bloom said gaily.

—I noticed he was at stowing away number one Bass. But to say or do something or cherchez la femme.

I have learn'd thy language; for I know his gross patchery, love. —Did set forth upon his good points. —How much is that a fact? Like madness is the very air O' the grape, Till the high fever seethe your blood to froth, and I beseech you,—which he in the Mater and now their pride and mettle is asleep, and there's an end; I have received some small kindnesses from him. Nothing at this time of year. I weigh my friend's affection with mine own part, I would cudgel you.

Rest rubble, sprawling suburbs, jerrybuilt. Well, it's a fair hot wench in flame-colour'd taffeta, I am sworn not to see the brewery.

A warm human plumpness settled down on the unsteadfast footing of a person and don't meet him.

Again. Didn't you see. Mr Bloom's gullet.

High on Ben Howth rhododendrons a nannygoat walking surefooted, dropping currants. No. No more, no kin else, could I but catch it for a big deal on Coates's shares. Nice wine it is. The time of year. He smellsipped the cordial juice and, pulling aside his shirt gently, warning her: And is he if it's a fair question? He is poor; he crossed himself by 't: for myself, Mighty, and let me entreat you, faith, that I can.

Glowworm's la-amp is gleaming, love!

Mrs Dickinson driving about with scarlet harness. And a houseful of kids at home.

—Nothing in black and white, foul fair, the fox would eat thee; eat it.

Crème de la French. Say, what with Owen Glendower's absence thence, who never promiseth but he has Harvey Duff in his own, tooth and nail. Child's head too big: forceps. With all my heart. Ha! Lucky I had prosperity.

Chump chop from the grill. There's neither honesty, manhood, be strong in whore, allure him, and shortly murdered. Here we are. Sucking duck eggs by God. Paying game. There he goes into Frederick street.

So he was painting the landscape with his mouth. I'm going to plunge five bob on my own. Settle my hat straight. My name is Cashel Boyle O'Connor Fitzmaurice Tisdall Farrell, Mr Bloom said. Shall the son of a baron of beef. No.

Hot livers and cold-moving nods they froze me into your mouth. Where is he living, clipp'd in with Whelan of the world. Cold water and gingerpop! I say, my very good friend, and be no longer guilty of this life, her veil up. Mr Bloom said. Gasballs spinning about, crossing each other; each takes his valour shown upon our crests to-morrow, Ned. O! —Zinfandel is it?

Alcibiades the approaches wild; who, in purity of manhood stand upright, elbows on table, ready for a valiant lion, and persuaded us to provide, and you lie. Thou hast redeem'd thy lost opinion, and lend me thy hand: thou art even natural in thine art.

Wouldn't have it so; a tun of man; but yet no coward, Hal! The flutter of his breath came forth in short sighs.

Who struck this heat up after I was writing of my intemperance: if there come a wallop, by four o'clock, early at Gadshill! Sixteenth. How fain would I could have better spar'd a better feast never behold, you are more beholding to the protection of the brain.

Let them come; they know not what else to do; I could render one. Y. So he was singing into a great strawcalling. But, sirrah, make them drink, upon his lip; and in account nothing so much I love and tendance all sorts of hearts; yea, my good lord, join with Mortimer, Capitulate against us like an albatross. Yea, and to tickle our noses with spear-grass to make his wishes good. Raise Cain.

Mr Geo. The spoon of pap in her throes. Can't see it. No use sticking to him? Led on by la maison Claire.

His downcast eyes followed the silent veining of the world admires.

Have another quart of goosegrease before it came off.

—There he goes into Frederick street. Does no harm. Gaudy colour warns you off. Well, he mutely craved to adore. Flies' picnic too.

Next chap rubs on a dusty bottle. All skedaddled.

Husband barging.

He does canvassing for the time of the vilest earth is with the band.

They stick to you? Shelter, for tears do stop the mouth of deep defiance up and down with them; faults that are, revenges: crimes, like a bladder. I don't believe it.

This is the gentleman does be visiting there? Turnedup trousers. He backed towards the shopfronts. Our Lady of Mount Carmel.

—I'm sitting anyhow, Nosey Flynn said. Looking for trouble.

Lubricate. Look at his mouth. Code. Trouble for nothing. Must have cracked his skull on the city marshal's uniform since he got Against renowned Douglas!

Dedalus' daughter there still outside Dillon's auctionrooms. The walk. A question not to see.

Purse. Then there's my Lord Northumberland, we will hold at Windsor; so did you, Lord Douglas, and sweetly felt it. Not one word to say Ben Dollard had a rod in my house.

Dockrell's, one of those fellows if you stare at nothing. Well mock'd. What may the Lord make us.

He's a safe man, a nightmare. Dream he had been visited: his honesty rewards him in her blouse of nun's veiling, fat nipples upright. Putting up in all places alike. Prickly beards they like.

Yom Kippur. But yet I love you well know, his tongue brushing his teeth smooth. Nosey Flynn said, hid herself in a dream for him. —Read that, she kissed me.

—though his right hand at arm's length towards the door: shall we be merry. Mr Geo. Different feel perhaps. Rest rubble, sprawling suburbs, jerrybuilt. O rare! Dolphin's Barn, the same.

—if promises be kept on every hand, his name, to be hated, then, as may not be slander'd with revolt.

I'd say. The day looks pale at his watch.

Have rows all the Athenian bosoms, and say, Where? Born with a recompense more fruitful Than their offence can weigh down by the leopard; wert thou a horse. Get you gone.

Might we but have that happiness, my lord. Cheapest lunch in Earlsfort terrace.

Mawkish pulp her mouth. —Of the twoheaded octopus, one that hath abundance of charge too, you want? Weightcarrying huntress. D. Serving of becks and jutting out of me! La causa è santa! Well, of comely virtues; for if I should pity him. Welcome, Sir John, and yet not ours. The money shall be done Than out of her stays: white. —There was one of those horsey women. Our late noble master! It is a virtuous man whom I have peppered two of their wealth.

If you cram a turkey say on chestnutmeal it tastes like that one of the land. You do yourselves but wrong to stir me up in groups and scattered, saluting, towards their beats. Mr Bloom smiled O rocks at two windows of the Burning Lamp.

Wherein crafty but in nothing? Good pick me up in cities, worn away age after age.

What was he;and 'gentle Harry Percy. Christmas turkeys and geese. Hostess, my lord. Had I so lavish of my youth. Knife and fork to eat from his horse, and make the assay upon him, and say,—as ever was laid; our gentle flame provokes itself, and thou'lt die a hundred thousand rebels die in this sack too: God help the feeble up, she said. Then passing over her I lay on her hair, earwigs in the reproof of many men I do not need your help: and, standing between the gaunt quaywalls, gulls, seagoose. Methinks thou art only mark'd for the station. Our poesy is as a cauterizing to the rightabout. Good pick me up. He and I feed not.

Herring's blush.

Let each take some; Nay, good my lord?

Burgundy. Burgundy. Mr Bloom smiled O rocks at two windows of Brown Thomas, silk mercers. There's much example for't; the one is anything. Stay in. Show us over those apricots, meaning peaches. Let this man Was born of woman. —Was he? Jugged hare.Nay, my lord, what is amiss plague and infection mend! No-one. —Darling! I hope well, he shall be out of my young Harry, I am one now: were all discharg'd!

Better.

I have a pain. Davy Byrne said. Perfumed bodies, warm, full lips full open, kissed her mouth before she fed them. P.

Feel a gap. Course hundreds of times you think good. Young and apt: our captain hath in her eyes. Percy, and we, as I said, snuffling it up. Your funeral's tomorrow While you're coming through the doublet, four?

No fear: no, M Coy said. Heavens! Give us that brisket off the hook.

Funny she looked soaped all over the line. He drank resignedly from his ex. I have shook my head and on my behalf; and tell him that calls not on me so. Look at what time of year. Does she love him?

Where thou wilt give away immediately.

C.

That thou art a beast art thou damned for cozening the devil come and roar for them,—and telling me Hope that dewdrop doesn't come down into the Empire.

Lord of Westmoreland.

Dublin Bakery Company's tearoom.

My plate's empty. Fruitarians. Undermines the constitution. It grew bigger and bigger and bigger and bigger and bigger and bigger.

He did come a wallop, by the leopard; wert thou a leopard, thou, like all the poisonous potions in the lying-in hospital in Holles street. How! Or so live, but that he did lead to fight against the softness of prosperity, with other like, my lord. Traffic's thy god, and so farewell.

Forget what we have suffered. Nay, task me to Molly, won't you? Only big words for ordinary things on account of the brain the poetical. P.

Crushing in the air with juggling fingers.

Still I got to know what he did oppose his foe; and now he's going round to Mr Menton's office. No; I ha' told him gently of our determination!

Or will I take now? An old lord of the forest from his three hands.

Pure olive oil. This sickness doth infect the very heart of kindness. Six. Someone taking a rise out of it. I often saw him in parliament that Parnell would come back from the castle.

Pebbles fell. But I know not which is too. Wait: was in Thom's. —Stone ginger, Bantam Lyons winked. She used to. The thoughts.

Indifferent. Wear out my welcome. Handker. Is that a fact?

What's to be spoonfed first. Trousers Good idea that. By the Lord Scroop.

Wouldn't live in fortunes! He studded under each lifted strip yellow blobs.

None? Come, neighbour Mugs, we'll share a bounteous time in different beds of lust; and so on. No grace for the hour before the exactest auditors, and I'm glad of it, then the others copy to be: read them thine. Quite a boy. Neither; 'tis hot: there's no purchase in money. Our hope in him I'll counterpoise, and then thou mightst have hit it. Sound to this change? Or will I drop into old Harris's and have the booty, if life did ride upon a Scot would save his soul, he said, but 'tis like that spoils the effect.

The cane moved out trembling to the left. Karma they call me coward, this horseback-breaker, this horseback-breaker, this Bolingbroke: and never learn'd the icy precepts of respect, and art indeed able to corrupt a saint. Will you leave me there? Playgoers' Club.

Brighton, Margate. He's been known to many in our own estate, when thou needst him there thou shalt have the world, if that. Indeed, my good lord, and deny't that lord; I myself at this time have employ'd him. Freeze them up at all the debt I never had an honest woman with picking thy pocket were enriched with any tinker in his own ring. Why he fixed on me? Next chap rubs on a cheque for me in with the glasses there doesn't know me, Apemantus? Mrs Riordan with the watch to see, I'll trust to your house. Ay, now, Hal, if once they join in trial.

War comes on: into the Pomgarnet, Ralph. Bare clean closestools waiting in the know. In Luke Doyle's long ago is that? Still in motion? Today. Putting up in the supperroom or oakroom of the ballastoffice is down.

When the sound of his irides. With hungered flesh obscurely, he made man politic; he has only sent his present want seems more than 's artificial one. Feel better then. Three hundred kicked the bucket.

Rock, the cankers of a dragon, and art, indeed; and would to God he does too much curiosity; in that. Round towers. Give it me. Cannibals would with lemon and rice. —And is that a prodigal course is like we shall stay too long. High voices.

So please your honour, she said.

Davy Byrne said. Why, Harry, an thou lovest me! A plague on thee, Hal? Most noble lord, to do, Mrs Breen said. Saffron bun and milk together. Hidden under wild ferns on Howth below us bay sleeping: sky. His Majesty the King. That quack doctor for the worst is filthy; and those our droplets which from niggard nature fall, yet all our fortunes.

Ay, four? My dearest master! Power could a tale unfold: father a G man.

Against John Long's a drowsing loafer lounged in heavy thought, gnawing a crusted knuckle. Ought to be half so kind to heart, to the animal too.

Useless words. If a fellow going in to be spoonfed first.

Mr Bloom. Burgundy.

Say thy prayers, and be hanged! What sayst thou, Whose fall the mark of his irides. What does his lordship; pray, signify so much have sway'd your majesty's good thoughts away from grace: there shalt thou be son to me of.

Stand.

The mere want of government.

Whether on the sexual. Albert Edward, Arthur Edmund, Alphonsus Eb Ed El Esquire.

Kill me that thou art, a heavy cloud hiding the sun at midsummer, Wanton as youthful goats, wild as young down, swallow a pin sometimes come out on his coat.

He had a hundred upon poor four of us; not to-night, my lord. Heads I win tails you lose. Iron nails ran in. Absurd. Let our drums strike.

Yes, the more it is said, snuffling it up.

Here goes. Mr Bloom coasted warily. P.

Mrs Breen said. If thou hatest curses, stay till all our fortunes in our eyes without our ears: Thou art true and honest; ingenuously I speak like friends: this comes off well and excellent. He never did encounter with Glendower: I hunted with his mouth and munched as he is worshipp'd in a poky bonnet.

They say they used to give the poor buffer would have to call tepid paper stuck. Paddy Leonard said with scorn. Milly's was. Josie Powell that was with the glasses there doesn't know me. It's always flowing in a swell hotel. Could buy one of his right hand at arm's length towards the foodlift across his stained square of newspaper.

Nasty customers to tackle. Another king! His smile faded as he will, Mr Bloom. Keep you sitting by the dram; Ay, marry, what blows, what with the armed hoofs of hostile paces: those opposed eyes, woman. Immortal gods, I clear'd him with a platter of pulse keep down the stings of the flesh. Saint Alban's, or all the lofty instruments of war: to forget their faults, I do thee that friendship. Nasty customers to tackle. Why those plainclothes men are the moon's an arrant thief, of his. A man and ready he drained his glass. Trousers. Swagger around livery stables. Wants to sew on buttons for me in his sleep. It's always flowing in a high respect, and shortly murdered. Here's good luck. Not a bit.

No use sticking to him.

No; 'tis inferr'd to us all.

That might be other answers Iying there. Iron nails ran in. First turn to the king knows at what I'm standing drinks to! Is coming! Father O'Flynn would make hares of them: I'll teach them to your lordship, here is my lord.

Here come our wives, and amen! Let it not?

We'll hang Joe Chamberlain was given his degree in Trinity he got a run for his friends are dead, doors, that keep their sounds to themselves. Go, Ye cuckoo!

Alderman Robert O'Reilly emptying the port into his title, and ne'er prefer his injuries to his word, out. Piled up in groups and scattered, saluting, towards their beats. These letters come from your father. Meshuggah. Nature abhors a vacuum. Hidden under wild ferns on Howth below us bay sleeping: sky. Heavens! Wonder would he feel it. What's that? I cannot choose but bring him quickly on.

Amen. —Not here. Mr Bloom said, the lines faint brown in grass, on my coat she had her hair, for instance.

City Arms hotel table d'hôte she called it till I show you. Pendennis? Busy looking. Bleibtreustrasse. Feast of Our Lady of Mount Carmel. England did never see such pitiful rascals. Do you dare our anger? U. Peace, good brother: his brother's brother. Is coming! C. If I hope it wasn't any near relation.

Three?

—Ay, if every owner were well plac'd, indeed, the noble timon to this change?

Useless words. Cuisine, housemaid kept. Alcibiades is banished: hear you speak of you to a secret touch telling me memory. Nay, let's be provided to show Lord Timon; this house. Like a man, a home to his stride.

Lucilius. She's engaged for a valiant lion, or the look. I'm sorry to hear that.

Top and lashers going out there: Ballsbridge. Wouldn't have it. If thou wert the ass broke the brittle paste and threw its fragments down into the bosom of the waters dull. Straw hat in sunlight the tight skullpiece, the flies buzzed.

I come to supper tonight, the flies buzzed, stuck. Freely, good Prince Hal, art thou?

If I threw that stale cake out of her new garters.

There's gold; do you do? Supposed to be a lord; I lack some of those convents.

She's not exactly witty. The harp that once did starve us all. Wine. Must go back for that lotion. Mrs Breen asked. I trouble you for a glass of burgundy and let them be as they are.

His gorge rose. Image of him. Wispish hair over her ears. Light, life and love thy husband?

Come, neighbour Mugs, we'll take two of your small Jamesons after that and a portent of broached mischief to the gods can witness: I prithee do thou never leave calling Francis! Take one Spanish onion. Mr Bloom on his coat.

Lozenge and comfit manufacturer to His Majesty the King. Vitality. Don't like all mankind, that shows the ignorant a kind of food you see produces the like conception in our land by the tap all night.

Tea. That's in their theology or the look. Top and lashers going out. Jingling harnesses. —His name is Cashel Boyle O'Connor Fitzmaurice Tisdall Farrell, Mr Bloom smiled O rocks! For you my staff of office did I put found in his eyes.

Send him back the half of a building, sacrifice, kidney burntoffering, druids' altars. Why hast thou given? Feeling of white.

Can't stop, Robinson, I am in some liking; I give thee this pennyworth of sugar-candy to make vast Neptune weep for aye Be crown'd with plagues that thee alone obey. Mity cheese. —Who's standing?

Underfed she looks too.

Put you in your own bread and butter.

Half-moon, under whose countenance we steal.

Silly fish learn nothing in a poky bonnet. That time serves still. No more the thirsty entrance of this. Bobbob lapping it for a Fairview moon. Do so, sir; which, failing, periods his comfort.

A.

I rob the thieves are scatter'd and possess'd with fear so strongly that they will away presently. O! Where my stomach finds meat; or, rather, not for 't, and pluck up drowned honour by the smell or the priest won't give the breast year after year all hours of the charge set down but yesternight; when the mother goes. Never looked.

Sweet name too: caramel. Well, of purpose to have tingled for a certain fascination: the name. Not smooth enough. Mr Bloom, quickbreathing, slowlier walking passed Adam court. —Trouble? Fruitarians.

Well, 'tis cold, to save our heads, and that no man might draw short breath to-morrow dinner-time, the absolution. Better consider what you know you're not to: man always feels complimented.

A.

What wouldst do then, because thou art out of house and ulcerous sores would cast the gorge at, by this hand. That nature, being daily swallow'd by men's eyes, and taste Lord Timon's mad.

O, that's certain; I did not think thou art Harry Monmouth. You can't lick 'em. Lords, give us a good bellyful of that priestylooking chap was always squinting in when he was eating. Mr Byrne, sated after his yawn, said with tearwashed eyes: Iiiiiichaaaaaaach! Wimple suited her small head. My nephew's trespass may be known by the dram; Ay, marry, what time do such a commodity of good names were to say Ben Dollard had a base barreltone. In aid of funds for Mercer's hospital.

Trouble? Eat pig like pig.

Don't see him on the car: wishswish.

Mark now, thou hast me invited to come out of making money hand over fist finger in fishes' gills can't write his name on a bed groaning to have tingled for a certain time to jest and dally now? Might be settling my braces. Smart girls writing something catch the eye at once from the court at door would speak with you,—I don't believe it. Blown in from the old friends, if Percy be alive, I'll be sworn; I, I am not like Timon. May, and yet he talked very wisely, and you bound them, the same. —What? A cenar teco. There are some like that, she kissed me. Feast of Our Lady of Mount Carmel. Come, Mr Bloom, quickbreathing, slowlier walking passed Adam court.

An illgirt server gathered sticky clattering plates. I shall never hold that man goes up and down-trod Mortimer as high i' the air a thousand years. Gasballs spinning about, crossing each other, passing away too: God keep lead out of all the greenhouses. Art thou not beggar. Must be strange not to thee, coz, of one doubtful hour? Hot mockturtle vapour and steam of newbaked jampuffs rolypoly poured out from Harrison's. Aids to digestion. Dull, gloomy: hate this hour.

No, snuffled it up? Else he had the good fortune to meet with the job they have bought me lights as good use of it himself first. Save. Girl passing the Stewart institution, head in thy ranks, but not remember'd in thy last work, shap'd out a moderate table. Bloo Me? No families themselves to battle, and he slanders thee most grossly. Not go in and blurt out what you tell them.

Stopped in Citron's saint Kevin's parade.

What art thou mad?

Let him tell it to me? Will this content you, upon instinct, you ran away upon instinct.

Nothing in black. All trotting down with shallow jesters and rash bavin wits, soon kindled and soon burnt; carded his state, this great flood of bloodhued poplin: lustrous blood. —I'll take a stone ginger, Davy Byrne said. Molly. Screened under ferns she laughed warmfolded.

Silly fish learn nothing in the air.

Driver in John Long's a drowsing loafer lounged in heavy thought, gnawing a crusted knuckle. More shameless not seeing? And may the Lord make us. With me?

It is noised he hath a mass of treasure.

Would 'twere so: if not, my lord, be more myself. Better consider what you tell them.

S. Soft warm sticky gumjelly lips. 'I go, Break open shops; nothing can seem foul to those that under hot ardent zeal would set my teeth nothing on edge, nothing doubting your present debts.

Like to answer them all on. With a gentle finger he felt ever so slowly the hair combed back above his ears. There's more gold; I ha' told him on't; and would to God he came back from the east unto the west, so are they living who were the most villanous house in Christendom. —Certainly, sir. I hope I shall have much to say thou'lt enter friendly. What have you there?

Like a few olives too if they lose sixpence. O! 'Sblood, my lord!

He did come a wallop, by God, he said.

—Getting it up?

E.

Code. All yielding she tossed my hair. Ay. Out half the night we were enforc'd, for Timon's sake let's yet be hungry!

Grace? That was that chap's name. Thou knowest my old ward; here comes lean Jack, then. Devil of a job it was that ad in the withers out of all erection. Hope that dewdrop doesn't come down into the sunlight through a heavystringed glass. Hang Ye, i' faith. Never know whose thoughts you're chewing. That I had rather be at a breakfast of enemies than a struck fowl or a dog, and I will, my lord. Sun's heat it is a common remark.

Plagues incident to men too they gave me nutsteak?

—and what should I be not four by the squire further afoot I shall be my retentive enemy, and all what state compounds but only painted, like tapsters that bid welcome,and giv'st such sarcenet surety for thy good name live with the approval of the issue any way.

Yea, two more already.

Are not inherited.

High tea. Heads bandaged. Speak, and those kin which in the house of parliament a flock of pigeons flew. When I know not; and at my dearest cost in qualities of the month. Bad for their tummies. Sizing me up I daresay from my hand against the softness of prosperity, with wadding in her throes.

He always walks outside the lampposts. Give me the sugar thou gavest me, sir, I trust thee, and fearful scouring Doth choke the air with juggling fingers. Want to be so valiant as Hercules; but say thou art accompanied: for the scrapings of the sea, being wanted, he says. Mr Bloom asked. The not far distant day. Wretched brutes there at the cattlemarket waiting for the baby.

Let us make the assay upon him, my lord; and I'll amend my life,—and that's the style. —Seven d.

Canst thou the unicorn, pride and mettle is asleep, and has left me in words only, I heard.

Since I fed the birds five minutes. Lovely forms of women sculped Junonian. All the odd things people leave behind them in a state.

Roundness you think good.

Diddlediddle—Sad to lose the old days of goodman Adam to the public body, which now the public. We attend his lordship; and 'tis no little reason bids us speed, to ease them of commendation. Must have felt it. He withdrew his hand in his eye.

What a mental power this eye shoots forth! Two fellows that would set whole realms on fire to go to bed with a rag or a handkerchief. Sunwarm silk.

Stick it in a hand of Mr Bloom, Nosey Flynn said. —I don't wear such things Stop or I'll tell you, take no warning by my coming. I. I must go after him.

—You're right there, my alcibiades. O, Mr Bloom ate his strips of sandwich, fresh clean bread, with ravishing division, to wipe out our ingratitude with loves above their quantity. Plait baskets. Combustible duck. She twentythree. They want special dishes to pretend they're. Why, you see.

Handsome building.

And here's himself and pepper on him yet.

Very hard to bargain with that sort of a king.

—What is thy companion. Mr Bloom moved forward, raising his troubled eyes.

Flattery where least expected. What viler thing upon the ground, my good lord; the bounteous housewife, nature, being with his mouth twisted. —She's engaged for a penny! Now, by this rascal, if we live, we should ne'er have use for gold, rid me these villains from your distracted soul; there is not so soon be drawn. Germans making their way everywhere. You are straight enough in the point; why, let me ne'er see thee. How is that? —No, Percy I killed myself, there's no room for faith, truth, domestic awe, night-rest and neighbourhood, instruction, manners, pray'd you to know someone on the gusset of her. —Roast beef and cabbage. Sitting on his throne sucking red jujubes white. Come, Mr Bloom cut his sandwich into slender strips. A bony form strode along the gutter, scarlet sashes across their boards.

I intend to stain with the absent king in deputation left behind him here, take me, Bantam Lyons came in.

How is the meaning. Here come our brothers.

Countrybred chawbacon.

Rawhead and bloody bones.

It is. Six. No grace for the Freeman?

The blind stripling did not turn away. Would I trouble you for a certain time to walk the earth garlic of course, if rightly taken, halter. Eaten a bad egg. This fell whore of thine hath in her mouth. Tell me all. Vintage wine for them. Must be selling off some old furniture.

How? We steal as in a pitch'd field. A fool go with you; you have a child tugged out of her new garters. Old Mrs Riordan with the red wallpaper. His eyes beating looked steadfastly at cream curves of stone. Three times hath Henry Bolingbroke made head against the softness of prosperity, with ravishing division, to be delivered as far as my prisoner. They have no power to raise him, to see the brewery. She was crossed in love by her eyes. God. He gazed round the stooled and tabled eaters, tightening the wings of his, and is very good friend, and gave the tongue an helpful ornament; a poor unmanly melancholy sprung from change of mood Spurns down her late belov'd, the same horses.

It's a great shame for them, drown them in trains and cloakrooms. There's a van there, Nosey Flynn said. Undermines the constitution. Pleasure or pain is it not about him, old chap picking his tootles. Eat you out of the Mansion house. It's after they feel it if something was removed. He always walks outside the lampposts. —Anon, anon, sir.

What sayest thou, Kate; whither I go, strong theif, when on the Tuesday Mr Bloom came to Kildare street. Take off that white hat.

Manna. Something galoptious.

Sad booser's eyes. Watch!and giv'st such sarcenet surety for thy theft hath already made thee butter.

Seems to a secret touch telling me Hope that dewdrop doesn't come down into his shoes when he must need me. Yes.

Tom Rochford nodded and drank. Must be a new batch with his help these fourteen days. His name is Cashel Boyle O'Connor Fitzmaurice Tisdall Farrell, Mr Bloom cut his sandwich into slender strips. Mr Bloom walked on again easily, seeing ahead of him.

I'll break thy little finger blotted out the play: I prithee, Harry, you know we of the forest from his bladder came to age, and away! It blows a man doth of a hair was never seen in you. Mrs Moisel.

Unsightly like a shepherd, Approach the fold and cull th' infected forth, but say to you Hang in the fashion. Give me a fool's.

Never put a dress on her.

That's the fascination: Parnell. He walked on again easily, seeing ahead of him. Swish and soft flop her stays: white. No; thou layest the plot and the rest of your open bounty tasted, hearing the surges threat: we have sinned: we must neglect our holy virgins to the senate! P. Just as well as you, walk near: I'll to Sir Nicholas Gawsey hath for succour sent, and said he would cudgel him like a man used to give poor jades the bots; this to my fortunes to me, Reggy!

Banishment!

Opening her handbag. Flattery where least expected. —What is honour? —All on the ballastoffice is down.

Playgoers' Club. POST 110 PILLS.

Torry and Alexander last year. —For near a month, and go to Molesworth street is opposite. Tune pianos. Eat pig like pig. Lot of thanks I get. I tell thee what; he's much out of him. —That's the man I know a fellow going in to be spoonfed first. Thy ignomy sleep with thee their patron; and so become a rare bit of horseflesh.

A goodly portly man, watchful among the silverware opposite in Walter Sexton's window by which John Howard Parnell passed, dallying, the rum the rumdum.

With hungered flesh obscurely, he is, old Jack; die when thou needst him there thou shalt.

His hand fell to his lips. —Sad to lose the old applewoman two Banbury cakes for a bride, and very willingly. And with a rapt gaze into the army helterskelter: same fellows used to say or do something or cherchez la femme.

Still! At my tent the Douglas, that. Make war breed peace; make the Douglas' son your only mean for powers in Scotland being thus employ'd, Shall follow in your watering, they approach sadly, and that sprightly Scot of Scots, Douglas! You will make black white, Nosey Flynn asked.

A diner, knife and fork upright, elbows on table, ready for a bride, and said he would himself have been a banish'd woman from my hand against the High school railings. If manhood, be gone then. Who gave it to Flynn's mouth. They are not Boyl: no levell'd malice infects one comma in the best form of government, being, worse than mad: I will beard him. Sss.

There's a van there, really sweet face.

I shall have his bargain; for thou art degenerate. Wonder if he sack fair Athens, mindless of thy worth, forgetting thy great deeds, when man was dead?

P. Molly, colour of her. He moved his head uncertainly.

Twilight sleep idea: queen Victoria was given his degree in Trinity he got a humour there does not live a man, here it began. Professor Goodwin linking her in the insurance line? Peace and war is nothing more.

Very good for ads like Plumtree's potted meat. Get outside of a servant brow. Handker. What has he the leisure to be delivered as far as to play with mammets and to your lordship, he did when he was perfumed like a clot of phlegm.

Absurd. A nice salad, cool as a man knows where to have him spend less; and what with the braided frogs. My lord, bless'd, to men too they gave me in my pannier are quite starved. After their feed with a dose burning him. Ought to be asked. Almost taste them by looking.

Let all my friends else?

Something occult: symbolism. Fool, I cannot eat it. —I'm off that white hat. Ham and his eldest boy carrying one in pudding time.

Please tell me true, so his familiars to his lips. —Zinfandel is it!and 'gentle Harry Percy.

He last asked the question. Suppose he was painting the landscape with his great name and estimation, and those musicians that shall bring it on the sexual. Australians they must be round with him! Got the provinces now. —Yes, sir. Cold statues: quiet there. People in the dead of night and see him on the parsnips. He halted again and bought from the river and saw a rowboat rock at anchor on the faster it grows, his creditors most strait: your importunacy cease till after dinner, that it was custard. More power, he says something we might express some part of nature.

Saw her in front. That speak'st with every tongue, consuming it with new monsters, whom he redeem'd from prison: all westward, Wales, Lord John of Lancaster, to see.

Nice wine it is. U. He'd look nice on the fat of the Mansion house.

Saint Patrick converted him to-day; and, bidding his throat strongly to speed it, nor claim no further; no villanous bounty yet hath pass'd my heart. Take off that white hat.

Her ears ought to imbibe.

Send him back the card into her untidy bag and snapped the catch of oysters they throw back in the recorder's court.

Unless you're in the viceregal party when Stubbs the park.

Dth, dth! The not far distant day.

—Stay, I would be as tedious as a skullpiece a tiny hat gripped his head.

Timon, sir?

They stick to you? Voice. Germans making their way everywhere. How now, and fought a long peace; make peace stint war; then let him have it so: and then he said.

And, Falstaff, and mark thee too; yet, I think she knew by the Tolka. Wine.

Nay, I knew nothing; for mine is money. Ought to be tough from exercise. They split up in all places alike.

Send danger from the hindbar in tuckstitched shirtsleeves, cleaning his lips.

Wealth of the shade, minions of the eminent poet A.

Mine, Hal, help me to my cousin Vernon's are not salty? What dreams would he have, not for 't, and farewell.

Cannibals would with lemon and rice. Why are you going? C. Thou art too bad, Nosey Flynn said, hid herself in a certain time to pay.

Sister?

But then why is he?

In Barbary, sir! Must answer.

Voice. John Howard Parnell example the provost of Trinity every mother's son don't talk of Timon. Lady, my master's passion.

You have no power to shame the devil shall have no. Only big words for ordinary things on account of the thieves are scatter'd and possess'd with fear so strongly that they wanted cunning in excess Hath broke their hearts. —And now he's going round to Mr Menton's office.

Two eleven. Increase and multiply. Tune pianos. The huguenots brought that here. Michaelmas goose.

He's been known to us; and, sirrah, henceforth let me entreat you. Arthur Edmund, Alphonsus Eb Ed El Esquire. He has almost charmed me from my profession, by smiling pick-thanks and service, and able horses.

She won in a poky bonnet. Devour contents in the supperroom or oakroom of the language question should take precedence of the trams probably. Imagine drinking that! Holocaust.

Then the earth than friends who can bring noblest minds to basest ends! She's in the realm Perceiv'd Northumberland did lean to him like a milliner, and tell him well to show them entertainment. He's going to throw any more.

Ancient free and accepted order. Not so, Nosey Flynn said. People knocking them up with gold and want! His heavy pitying gaze absorbed her news.

Those poor birds.

Never know who you're talking to. But who comes here.

Prepare to receive cavalry. —And here's himself and pepper on him, I'll see thee hanged first. Those literary etherial people they are all. Mr Bloom said.

I will talk to me I was wonder'd at: and here the smug and silver Trent shall run in a dream for him. Ay. Please take one. Could he walk in a thunderstorm, Rothschild's filly, with one consent of love and tendance all sorts of hearts!

Do we meet together!

The Athenians, by God. —Mina Purefoy swollen belly on a cheque for me. Well, of trenches, tents, of his napkin. Yet doth he give us a good bellyful of that feather to shake off my friend Whose tongue shall ask me for his friend that dips in the fumes. By your leave, sir; thus: time, had his part of a sudden after. Dosing it with my sword hacked like a house broke! Well, I can tell you we will set forth before the window and, but for the carver. Kind of a woman. That's the fascination: the brother. Heigh, heigh! Sir John?

They hate us youth: down with the sickness of health, I will talk to me, Mrs Breen said. Not today anyhow.

Seems to a secret book, scanned its pages. O, Mr Geo. Throng'd to?

Our staple food. Some chap in the know. Or no.

Lick it off. No, thou knowest none, but two even now. Still I got to know what you've eaten.

Wait. To conclude, this villanous saltpetre should be hanged: Charles' Wain is over the way in is she? Cauls mouldy tripes windpipes faked and minced up. What, art thou mad? Grafton street. Just the place.

He outgoes the very heart of kindness. There are some like that, she kissed me.

No accounting for tastes. I am ignorance itself in a new moon out, read me the superscription of these harlotry players as ever hangman served thief. It only brings it up again, and be no more valour in that line, Harry! —Tell us if you're worth your salt and be merry. Dinner of thirty courses.

In aid of funds for Mercer's hospital.

I first bow'd my knee unto this king of courtesy, I think might be Lizzie Twigg with him, Nosey Flynn pursed his lips.

After all there's a lot in that counter. Look at all in that line, Davy Byrne said He went on by la maison Claire. Only a year or so older than Molly. Poor Mrs Purefoy! I believe. Money.

His eyes said: Iiiiiichaaaaaaach! Par it's Greek: parallel, parallax.

—Who's standing? Alas! Mantailored with selfcovered buttons. Paying game. Top and lashers going out there: Ballsbridge.

You can't lick 'em. Women too. Why do fond men expose themselves to feed Than such as they are for the gods bless me, caressed: her eyes. Look at what I'm standing drinks to! The trumpet sounds retreat; the lion: dost thou pity him whom thou dost belie him: if I hang I'll make it known to put by money save hundred and odd pounds. Religions. That's right.

Could buy one. No fear: there is the justice being born that way and you too; but for shame be further spoken, that what thou deny'st to men too they gave themselves, manly conscious, lay with men lovers, a business that I ask. Your steward puts me off to the right. I prithee, Tom Kernan can dress. The devil rides upon a fiddle-stick: what's parallax?

Sunwarm silk.

You had rather hear a brazen canstick turn'd, or present, I'd say. Thing like that? Made a big deal on Coates's shares. Great chorus that. Ha ignorant as a bridegroom; and there's an end; I gave it to her cheek. Y lagging behind drew a chunk of bread. Nosey Flynn said. Moo.

So do we sin against our rampir'd gates, and, sirrah, make gold of that. No-one.

They split up in the air. Send her a bit of codfish for instance.

To aid gentleman in literary work. Night I went to fetch her there was that ad in the northwest.

'Tis honour with most lands to be remember'd with those medicals. I will, forsooth, have you there? Thing like that pineapple rock.

Shall show more goodly and attract more eyes than that which has undone thee: what does that.

Prescott's dyeworks van over there.

Nice quiet bar. Have they denied him? You have hit it.

What horse? Where is he if it's a fine order, Nosey Flynn pursed his lips. Just: quietly: husband. Landlord never dies they say invented barbed wire.

Strictly confidential. Indiges. Fare thee well: commend me to put him in her blouse of nun's veiling, fat nipples upright. The belly is the smoothest. You confess then, peremptorily I speak, no.

Two fellows that would. Where was that chap's name.

Apjohn, myself and thee after supper, and I'll provide. Scrape: nearly gone. Keyes.

My good lord, into our city with thy sword for all this flesh keep in a thousand pound.

—There was a rare bit of horseflesh. Birth every year almost.

—Kiss me, I'll be sworn I have shook my head my shames redoubled!

—She was taken bad on the premises.

Kosher. There's a priest. Myself. Hang him, bring him out at the Grosvenor this morning. Solemn.

Live by their wits. Hotblooded young student fooling round her mouth before she fed them. Have you a world of curses undergo, being with his harvestmoon face in a shoe she had two years ago, Nosey Flynn asked, taking the card into her untidy bag and snapped the catch. Best paper by long chalks for a Fairview moon.

Young May moon she's beaming, love. Indeed, Sir Walter see on Holmedon's plains: of prisoners Hotspur took mordake the Earl of March.

What is home without Plumtree's potted meat? Round to Menton's office.

Rats: vats. I'm sitting anyhow, Nosey Flynn sipped his grog. Today. Promising is the theme of honour's tongue; amongst a grove the very heart of kindness.

Till I be his steward still. Coming from the back garden. My lord, here is a squareheaded fellow but he would not wish to be a fault, and snorting like a bladder.

Paddy Leonard said. Gaudy colour warns you off. They wheeled lower. What is thy name. Afraid to pass a remark on him, thinkest thou? —I don't believe it. Painting is welcome.

Is coming! Nice wine it is a stream. Trousers Good idea that. He faced about and, bidding his throat strongly to speed it, to amend this fault: Marry, and I never promised, by my coming. There's a little higher than his own ring. Because life is a hundred and odd pounds.

U. POST 110 PILLS. —You're in Dawson street, Mr Byrne? Therefore, friends, as my coin. Night I went down to the number that may please the eye that woman has in the head upon which the ends of the flesh. Francis!

Get out of all cess. A procession of whitesmocked sandwichmen marched slowly towards him along the curbstone. Swell blowout.

Deliver what you bestow, in that beastly fury he has no rhymes: blank verse. Homerule sun rising up in groups and scattered, saluting, towards their beats. Mr Bloom asked.

The flutter of his belly.

Stand! Grub.

Watch him, burn! Thou shalt have the hanging of the forest from his book: What? Bankrupts, hold fast; rather than the sun begins to peer above yon busky hill! I'll tell the king himself. Got fellows to stick them up himself for that. —Mina Purefoy?

Did you, sir; which, for our consciences, the most needless creatures living should we read the scarlet letters on their throats without repugnancy? Are those yours, Tom? Settle my hat straight. Lady of Mount Carmel.

Kind of a ruin'd house. But there are people like things high. The fierce wretchedness that glory brings us. God pardon thee! That'll be two o'clock.

A man and all the rest re-told, May reasonably die and never learn'd the icy precepts of respect which the gods, I do not Believe it was collecting accounts of those horsey women. Pub clock five minutes fast. Show this gentleman the door.

What was it Otto one of whose heads is the meaning. Nosey Flynn said, hid herself in a thousand pound?

The day looks pale and with his help we shall have no strength to repent.

T's are. With me? Must. Stationer's just here too. His gorge rose. Still I got to know that van was there? What sayest thou to break the smallest parcel of a baron of beef. Brighton, Margate. —No use complaining. Nor are they such that these great towers, trophies, and let him forget. Davy Byrne said from his bladder came to go.

I prithee, lend me thine. And there he is. I care not while you have found me; for he is. Hear Ye, gorbellied knaves, to you.

Rats: vats. Won't look. Lord, that melted at the cattlemarket waiting for the clap used to call tepid paper stuck.

His five hundred talents.

Eat you out a good bellyful of that Welshman taken, halter.

Initials perhaps. Will you give us bold advertisement, that my occasions have found time to promise, when the lords and barons of the sea: and tell me true,—as I live;and 'kind cousin. Why say you can't taste wines with your son; when I come to speak of Mortimer; who have thought on special dignities, which looks like man, boy by boy,—yea, from high to low throughout, that poor child's dress is in trouble that way. I am a true prince; but not, let him have a child tugged out of him. Screened under ferns she laughed warmfolded. Hath stepp'd into a pocket, took it in the bearer strong, Sick in the manger.

Nectar imagine it drinking electricity: gods' food. Those literary etherial people they are.

Still David Sheehy beat him for the museum gate with long windy steps he lifted his eyes. I suppose. Didn't see me.

Freeze them up too. So hath the excuse of youth and opulency. Paddy Leonard said. No, I'll visit thee again. A squad of others, marching in Indian file.

Mina Purefoy swollen belly on a bed with a sprig of parsley. My heart. Light, life and love thy misery!

I just called to ask on the spot a master mason. What do they call them all on. Is it in contempt?

Denis will be a tasty dresser. Out half the night than to start a hare-brain'd Hotspur, Mars in swathling clothes, this thy creature, by George. Every morsel. M Glade's men.

The tentacles They passed from behind Mr Bloom said. Her eyes fixed themselves on him, Percy, thou stand'st single; thou'rt an Athenian, therefore seldom rich; it will be, so much. On my way.

Iron nails ran in.

Lights, more to your majesty? —What? Not yours, Tom? Mr Bloom said. No No.

Milly's was.

The bay purple by the way papa went to fetch her there was that lodge meeting on about those sunspots when we need your help: and still they have all the watch are at the Three Jolly Topers marching along bareheaded and his chin, new reap'd, Show'd like a leech. To a true piece of painting, which hath no man can breathe, and in at the wind, her belly swollen out.

Bolting to get it over; by God. Wonder if Tom Rochford nodded and drank. —as ever hangman served thief. My daughter weeps; she will not be there of them, and it holds well too; and canst use the olive with my life, and then the others copy to be filled. Must get those old glasses of mine. —He's out of the Irish house of commons by the Lord of Westmoreland, and go not, but it's not moving. Look down into the D. Do you not tell me all. Don't see him dissemble, know me, sir. He has legs like barrels and you'd think he was in mourning. Penrose!

What is it? Van.

O, how ample you're belov'd. Alas!

Handel.

Sss. That I had black glasses.

Wisdom Hely's.

All my babies, she said.

O yes!

Not half as witty as calling him base barreltone. Resp. I sentenced him to his side. The patriot's banquet.

Rock, the summer: smells. His gaze passed over the line. And I can.

Yet doth he give us a good one for the Freeman?

—Roast beef and cabbage. Downy hair there too.

And the Trinity jibs in their own blood that spills another. Running into cakeshops. Must be thrilling from the air. First sweet then savoury. He's the organiser in point of friendship? Take one Spanish onion.

First catch your hare. As we do turn our backs from our first swath, proceeded the sweet degrees that this body did contain a spirit, a cenar teco M'invitasti.

They spread foot and mouth disease too.

Afternoon she said. Upon the heels of an empty box, sir, we'll call up the gentlemen: they will know us by our faces; we have, so much as to use them toward a supply of money. Was born of woman.

O, it's a fine order, Nosey Flynn said.

Why, so much shall I understand thee; and your great flow of debts.

Be gone! Holocaust.

Thou art a fool.

If she had so many children. Hail to thee, Timon, this canker, Bolingbroke? It is. —their points being broken,—he bids you upon the true prince; no reason can found his state, seldom but sumptuous, showed like a house on fire, the flies buzzed. What, ho! They say it's healthier.

It all works out. Wouldn't mind being a waiter in a poky bonnet. No time to promise, when all's spent, as good a deed thou'lt die a hundred shillings and five tiresome pounds multiply by twenty decimal system encourage people to put him quite beside his patience. An the Prince and Poins there?

Sir Walter Blunt; semblably furnish'd like the meteors of a woman clumsy feet. —Pint of stout.

He drank resignedly from his ex.

—Getting it up. Bantam Lyons winked. Why we left the church of Rome. Why do they call me coward, Hal? Sloping into the D. His gorge rose.

Wait. Young Sinclair?

Provost's house.

Thou seest I am looking for the Chiltern Hundreds and retire into public life.

Where was that I come to a little life? Bubble and squeak.

Good glass of brandy neat while you'd say knife. Pyramids in sand.

He's in the days are foul and his drink dangerous. Vintners' sweepstake. Cap in hand goes through the doublet, four? P. Power those judges have. Silly billies: mob of young cubs yelling their guts out of all my company, nor good fellowship in thee than in a windmill, far, Than feed on. More man! Top and lashers going out.

Stream of life we trace. Well out of her. He holds your temper in a poky bonnet. What wouldst thou send it? Philip Crampton's fountain. Or no. Like a mortuary chapel. I have just come from a funeral. Tune pianos. Twilight sleep idea: queen Victoria was given his degree in Trinity he got Against renowned Douglas! Can't see it.

Tried it. —Watch him!

Hidden hand. Be't not in, and pay the debt I never in my mouth the seedcake warm and chewed. This owner, that you a cheese sandwich, fresh, lov'd, and set down by the bar blew the gaff on the oak, have with him. They cook in soda.

Strictly confidential. Who ate or something the somethings of the forest from his book: Not here. What talkest thou to a tidy sum more than you think. A cheese sandwich?

'Tis in few words, but shall be honourable. My lord the prince tell him.

—And now I must. P.

Interesting. Dublin union, lord, four, in short sighs. A plague upon you both!

There's a van there, Nosey Flynn made swift passes in the fumes. Cruel.

O! Trouble for nothing. Plait baskets. Get on. He doesn't chat. My nephew must not break my back and let his very breath, that I'll requite it last? Thou hast cast away thyself, being men of your son. Hands moving. All for number one Bass. Time enough to overcome him; and in some sort, these flies are couch'd.

May moon she's beaming, love! Pity, of force. The mere want of government.

P. What are their wills? I cannot choose but tell him that he did!

Tales of the earth. —In the pink, Mr Bloom said. That republicanism is the very worst hour of the time of the Burton restaurant. His eyes beating looked steadfastly at cream curves of stone. For answer Tom Rochford followed frowning, a clip-wing'd griffin, and fishes; you are not even registered. Big stones left.

Ladies? Hurry. Davy Byrne said. Be bold to tell a story too.

I did deny no prisoners: but the virtuous: I will never be a corporation meeting today. Now that I am thy friend. All kissed, yielded: in deep summer fields, tangled pressed grass, on each bush lays her full mess before you.

Wishes good. Every morsel.

Worcester, get thee before to Coventry; fill me a thousand pound. No, by our feeding to so great an opposition. Houses, lines of houses, streets, miles of pavements, piledup bricks, stones. How this world is given to virtue, and try the argument of laughter to the golden fool: all these Owe their estates unto him. The patriot's banquet.

I had black glasses. Yes: completely.

Pub clock five minutes fast.

Never know who you're talking to. The Malaga raisins. Postoffice. Can be rude too.

Orangegroves for instance. Wanted, smart lady typist to aid gentleman in literary work. Sirrah carrier, what a plague upon you instantly. Mrs Moisel.

There's no straight sport going now. Built on bread and butter.

'Tis much deep: and watch it all the good fortune to meet Northumberland and the half of them.

That is how poets write, the butcher, right to keep up the pettycash book, scanned its pages.

Returned with thanks having fully digested the contents. Easier than the dreamy creamy stuff. Aware of their lives. Going to crop up all the things they can learn to do; the sea's a thief, and he whose pious breath seeks to convert you, Peto; so did you, kind Varro.

Grace after meals. I. But the poor woman the confession, the stripling answered.

Was he? We but offend him. Fizz and Red bank oysters.

I know is damned: if they labour'd to bring a slovenly unhandsome corpse betwixt the wind. And think how such an idea? I rode along, he writes, there is boundless theft in limited professions. Torry and Alexander last year. Of whom, even the mere necessities upon 't. All kissed, yielded: in his eye: I come to think of it.

Poor fellow! Just at the cattlemarket waiting for him to so great an opposition. Cauls mouldy tripes windpipes faked and minced up.

Walking down by the tap all night. Nothing in black, for his own heart, to fly unto, if he receives: if there were any thing in thy quips and thy perfume, they mocked thee for ever.

Straw hat in sunlight. That one at the woebegone walk of him. And the mulled rum. His foremother.

Old Goodwin's tall hat done up with some sticky stuff. Here comes the fool with Apemantus: let's away; advantage feeds him fat while men delay. Who leads his power?

Bargains. More shameless not seeing?

Who found them out?

Scavenging what the band.

He's in there now with his mouth. Sister?

#Ulysses (novel) #James Joyce #1922 #automatically generated text #Patrick Mooney #Lestrygonians #William Shakespeare #plays #Elizabethan authors #1 Henry IV #1596 #1597 #Timon of Athens #1605 #1606

[tara-tchaisky]

Drifttfttft fanart ig lol

#transformers #transformers fanart #fanart #drift #drift mtmte #tf mtmte #drift fanart #tf fanart #transformers mtmte #rat king tara’s art #maccadam

[tara-tchaisky]

Tfa shattered glass doodles because I have way too much free time lol

Also thumbs up to @shenanisketches as I used their art as references for Starscream and Slipstream!

#transformers #transformers fanart #fanart #tfa #tfa fanart #sari sumdac #maccadam #bumblebee tfa #tfa starscream #tfa slipstream #tfa jazz #doodle #transformers shattered glass #shattered glass #rat king tara’s art

[tara-tchaisky]

Drift before and after quitting v@pe

#transformers #transformers fanart #fanart #rat king tara’s art #maccadam #drift mtmte #drift fanart #drift #mtmte #mtmte fanart #transformers idw

[tara-tchaisky]

Tfp starscream doodlehdhdgdggdhd

#transformers #transformers fanart #fanart #tfp starscream #tfp #starscream #starscream fanart #maccadam #rat king tara’s art #transformers prime #transformers prime fanart

[tara-tchaisky]

“15 minutes could save you 15% or more on car insurance.”

- Blurr probably

#blurr #tfa blurr #tfa #tfa fanart #transformers #transformers fanart #transformers animated #rat king tara’s art

[tara-tchaisky]

You heard what Rodimus said.

#rodimus prime #rodimus #hot rod #transformers #transformers fanart #fanart #transformers idw #rodimus says you are poor lol #rat king tara’s art

[tara-tchaisky]

He stepped on the bread!!

#transformers #transformers fanart #fanart #starscream #soundwave #rat king tara’s art #maccadam #transformers mtmte #mtmte fanart

[tara-tchaisky]

Yay Rodimus is doneeertegrdgrdrgdgtd (I’M STILL EXPERIMENTING STYLES BUT I’M RATHER HAPPY W/ THIS LOLS)

#transformers #transformers fanart #fanart #rodimus #rodimus prime #rodimus mtmte #rat king tara’s art #mtmte #transformers mtmte

[tara-tchaisky]

Quick sketch ft. Jazzprowl lol (BLOOD/ENERGON WARNING??!!?)

#transformers #tfa #tfa fanart #prowl #jazz #tfa prowl #tfa jazz #jazzprowl #jazzprowl fanart #prowl gets stabbed lol #rat king tara’s art

[tara-tchaisky]

Blurr says it’s time to drink water

#transformers #transformers fanart #fanart #blurr #tfa fanart #transformers animated #tfa blurr #tfa #rat king tara’s art #IT’S TIME TO DRINK WATER

[tara-tchaisky]

He is busy doing girlish things…

#transformers #transformers fanart #rodimus prime #rodimus #rodimus mtmte #mtmte #transformers mtmte #fanart #rodimus is so bbg lol #rat king tara’s art