#socs 2: blossom | Explore Tumblr Posts and Blogs

grimbanes · 1 year

Text

My Soulmate is Capitalism. (Kaz Brekker x GN!Reader)

Summary: "Of course I believe in soulmates - I have met mine. Capitalism is my mistress and I lay with her every night, I hold her close and she sings me promises of riches beyond any man's dreams." OR after a successful heist, everybody celebrates but kaz chooses to sit with the reader and they have a funny conversation.

WC: 2k

Genre: crack fic. pre-relationship, coming to terms with feelings, the rest of the crows being funny. you/your pov. kaz might be a lil ooc. reader and kaz are besties with a lot of tension.

A/N: i wanted to write something light hearted because my notifs are blown up rn, but this is gonna be a first part or prologue leading to confessions within a day or two. so stay tuned, i hope you enjoy this because there's more to come for this one. i wanted to try something more dialogue heavy for once. i forgot how funny kaz could be but i was reading chapter 2 of SOC again and my god hes so funny.

TW: violence, usual six of crow warnings, kaz laughing.

“So you admit that you’re the thief?”

The young man in chains wanted to laugh, he really did. It wasn’t in his nature to laugh at idiocy - if he made a habit of it, he’d be laughing permanently and that seemed rather tiring.

“I’m a vigilante, of sorts,” He replied smoothly, adjusting the shackles on his hands from where he let them rest between his legs, being sure not to touch his bad leg even when both were chained to the rickety, barely held together chair he was perched upon.

“You gonna give it to the poor?”

“I am the poor,” Kaz said. He had to egg him on. His entire plan was resting on the fact that the Stadwatch were full of the most kruge hungry, lazy, arrogant fools to ever be shoved from the womb of Ketterdam’s damp streets.

It earned him a fist to the face, cracking down against his scarred cheekbone and he felt dizzy - recoiling from the rising tides that filled his tight lungs, daring to attempt to drag him under the murky, corpse riddled depths. It was only a moment of touch, but a moment enough that it numbed the pain that should be blossoming through the nerves in his face.

“Filthy street rat,” The guard scoffed at him, shaking his hand to evidently ease the pain from hitting him. Soft bastards.

“Street rat, urchin, pickpocket, they’re all the same. You can think of something better now, can’t you? Let me give you a hand: I prefer the term businessman, opportunist or even idealist, on a good day, ” The young man in chains taunted, leaning back into his seat and making himself comfortable, only the weight of rusting metal clamped around his bare skin giving him any discomfort.

He needed the officer closer. Just that little bit closer.

He didn’t miss the slight hobble in the guard’s right foot, or the consistent shaking in both of his hands. Perhaps he had skipped a meal or was otherwise unwell, either way, it posed an opportunity for him that had the young man scheming. Like any skilled thief, he could take himself out of his chains in mere seconds with the gentle caress of cool metal, a flick of the wrist and a soft praise, the lock would bend to his will and snap open, but not yet. With guard in his space, he could set the rest of the plan into motion and trust in his schemes to carry the others to do their part too.

The Stadwatch officer reached to fist his hair and Kaz braced himself, tongue in cheek and eyes locked on the hand reeling back and preparing to be delivered swiftly into his nose. A single second window was all he had. So he counted. He waited three seconds, inhale, exhale, inhale, and with a loud clink, his wrists were free. Kaz lowered himself down, arms shooting out to wrap around the officer’s hips and he hoisted himself up to his full height, the chains on his feet clattering away and he was dropping the officer onto his back with a heavy thud, dust filling the air in the dark room.

He didn’t hesitate to grab his cane from where it was left propped against the wall and raised it with a confident grip, the weighted head connecting with a sickening crack to the side of the man’s head. Exhale.

“Can’t have this tarnishing my perfect record,” Kaz mumbled, taking an uneven step back and leaning heavily onto his cane, stoney eyes scanning the surrounding room. It was dark out, possibly. Around four hours he’d been sitting with his eyes closed, counting every second and minute that passed, as he’d been stripped of his hat, coat, gloves and cane. He pushed his bare hand through his hair, away from his face. Right about now they should be-

The door threw open, and expecting Jesper, Kaz opened his mouth the mutter a threat about almost being late but instead, he was met with the one person who managed to make him hold his tongue. The one person who had him on his toes, who encouraged his behaviour, the only other person who knew what it was like to be raised by Ketterdam. You. With your mischievous smile, dirt smudged against your cheek and eyes sparkling at him with so much mirth that it had him wanting to return the pure joy you always seemed to radiate. You were always at your best when your pockets were full of trinkets that didn’t belong to you.

“Where’s Jesper?” Kaz inquired instead, stepping past you and out of the door and he didn’t even want to think on why the soft scent of morning dew flowers even managed to stay clung to you in dangerous jobs like this. He hobbled down the narrow corridor, leaning majority of his weight into his cane as his leg began to ache, the cold chill of the room set deep into the broken bone - he’d definitely been sat still for too long, it was nearly unbearable.

“Covering Wylan’s escape,” Your voice chimed from behind him, quiet steps masked in time with his own uneven gait. He eyed you from the corner of his alert eyes and he thought you were possibly the most addicting thing he had ever laid his eyes upon, even in dim light, in the face of danger, the possibility of death still thick in the suffocatingly stagnant air.

Kaz couldn’t find it within himself to be mad that Jesper had gone against his explicit orders to stick to the plan, no detours, no changes. That only meant that you had done your best to adapt to the change, to do your part and still come for him, and you had done it well - he figured he owed you a drink. Or a necklace. Or a bullet between your enemy’s eyes. Whatever he could do, he would do it for you, just to show he valued your set of skills in his arsenal. The entire plan rested on Jesper breaking Kaz out of interrogation before the Stadwatch completed the paperwork and locked him in a cell for Ghezen knew how long.

┕━━━━━━━♔━━━━━━━━━━━━━━━━━━━┙

You collapsed into your seat with a sigh, head tipped back and the sound of the bottle of whiskey was already being passed around, glasses clinking and the unshakable adrenaline remained buzzing under everybody’s skin. Another successful heist meant another fifteen thousand kruge in your coffers. You heard the seat beside you be dragged out and the smell of dark coffee flooding your senses, warming your sinuses. Your eyes flickered open in the warm lighting, falling upon the familiar figure that seemed to always be in your shadow as of late.

Kaz slid a cup and saucer your way, bitter dark coffee swirling in the fine china and you felt yourself ease a little more. He had a way about him that always left you feeling a little recharged - maybe it was the fact he always brought you a cup of coffee when he made himself one, always waking you up and giving you the illusion that it was him doing it. Clever, really, the sly bastard. You held onto the little plate with a smile, fingers hooking into the handle as Kaz sat himself beside you, cane rested against the table and his usual coat and hat abandoned somewhere in the club.

“Boss will have our heads for being in the club after hours, you know,” You teased.

“I am the boss,” Kaz muttered in retort, his usual eyebrow quirk present as he stared.

“Oh yes, of course, my apologies, Master Brekker,” You pressed, giving him a little nudge with your elbow and not missing the slight quirk of his own lips, barely present other than the way only one side of his mouth raised.

The young man rolled his blued hyacinth eyes in his usual manner, his entire being just screaming familiarity and you felt comfortable. At ease. Brekker could handle himself in a gunfight, a fist fight and any game of wit. His tongue was sharper than most knives, his words the coldest bullet to explode your brains against your own floorboards and that was a comforting thing in the Barrel.

“Do you believe in soulmates?” You found yourself asking, swirling the dark coffee in its cup between your hands, holding it close to your face and studying the young man beside you.

"Of course I believe in soulmates - I have met mine. Capitalism is my mistress and I lay with her every night, I hold her close and she sings me promises of riches beyond any man's dreams,” Kaz spoke with utter sincerity, sipping his own coffee and studying down at the manifest in front of him, pen in his other hand.

“Geels was right, you do only talk in metaphors,” You mumbled with clear disappointment, eyes cast upon your friends across the room as they drank their alcohol and made merry, celebrating the night’s events.

Beside you, Kaz stopped writing. In fact, he set his pen down altogether and a sigh left through his nose. You didn’t want to turn to look at him, didn’t want to show your disappointment - it was very rare you ever got a real answer from him, one that wasn’t a deflection or some mirror of the reputation he spent so long building. Sometimes, you just wanted a conversation but you knew choosing Kaz for that was foolish to begin with.

“As I said to Geels, that wasn’t a metaphor,” Kaz offered the truce, rather than submitting to his usual silence whenever he had upset someone.

“Is this your way of telling me that you quite literally sleep with money in your bed?” You asked, perplexed and turning your head to fully look at the Barrel Boss’ side profile.

“Yes.” Kaz sipped his coffee, leaned back in his seat and tapped a gloved finger against the surface of the table between you, “Thousands of kruge make my pillow and keep me warm in the night.”

And you laughed. You laughed louder than you ever had, hand slamming against the table and full body tipping forward, coffee set aside as you nearly choked on it. Kaz Brekker had told a joke and it was devastatingly funny, the deadpan delivery more than enough for you to be sent into a room filled with giggles. It had the others across the room staring at you with perplexity, glancing between both you and Kaz and you didn’t miss the way his body shook just that little bit, a hint of a laugh in his body language and smile hidden beneath the cup of coffee he was sipping on.

“You are so lucky that I adore you so much else I would be sticking a bullet through your brain right about now,” You giggled, miming firing a gun at him with your fingers and you snorted again, gripping onto the edge of the table.

“Careful voicing your affections so loud, one might think you’re being sincere,” Kaz’s smile seemed to shine in his eyes, leaning a little closer to your space and it set you off again, your hand slamming against your hand in an effort to stop your little outburst.

***

“They flirt with violence?” Nina dared question, whiskey in hand and staring at the exchange with confusion fused with joy, knowing damn well she could use this against the both of them in future. I mean really, who could adore anyone with a haircut that bad? She shook her head, utterly flummoxed.

“I don’t know what’s more unsettling, seeing Kaz smile or seeing Kaz make someone just as bad as him laugh like that,” Wylan shuddered, yet unable to look away.

“I think it's sweet. It really shows that there is somebody out there for everyone,” Inej smiled, eyes softening as she studied the exchange and holding her hand above her heart.

“Demjin made somebody laugh, I think we should take them both to a medik,” Matthias grumbled, earning himself a shove from Nina.

“Well I think-” Jesper dropped into his seat, leaning into where they had huddled inwards and grinned. “It’s creepy. I mean c'mon, imagine if anything happened between them. He’d go absolutely feral. It's so human.. I don’t like it.”

#crack fic #kaz brekker x reader #kaz brekker x you #six of crows #grishaverse

558 notes · View notes

berrysweetboutique · 5 months

Note

Hello! My friend told me about your Wordpress blog from 2010: a Splash of Color: Pastal Rainbowcy, and we have been reading it together! We have been really enjoying my reading experience but the links to the images on most of the chapters are broken. If you still have access to the images, we would love to read the story in its original intended formant! we love your work and can’t wait to read more (we are currently at Gen-2 Chapter 3 with Cherry Blossom 🩷)

Hey!! Sadly its an absolute mess over there D: but i did convert it over a while ago so it is still readable!!

https://cowplantberry.tumblr.com/tagged/SoC%20Pastel%20Rainbowcy/chrono

thanks for reading its so old now hahah T_T ♥

#link should be fixed now might need to get on a computer.... >.>

16 notes · View notes

etchedstars · 1 year

Note

robin. and and,,, nina :) (i tried sending ppl from two different things to give you Options)

omg hi bread tysm

robin !!

1: sexuality headcanon - lesbian !!!!!!!!!!!!! omg !!!!!!!!!!!!!!!!!!!! also robin is a she/they user Btw if you even care

2: otp - RONANCE [homosexual cheering]

3: brotp - scoops troop scoops troop

4: notp - stobin omg ,, vomits and dies

5: first headcanon that pops into my head - doodles everywhere . all over her arms. little stars and hearts and random scribblings also she has a denim jacket with a bunch of pins and a similar amount of doodles in sharpie

6: favorite line from this character - we all die :) my little :) child :) friend :) its just a matter of :) how :) and when :) (i just mistyped :) as :0 and :( several times oops)

7: one way in which I relate to this character - useless lesbian in the queercoded you sorta get gay vibes way until. until i explicitly say something and then everything just falls into place

8: thing that gives me second hand embarrassment about this character - nothing she is perfect WAIT NO i got one when she was w nancy complaining abt her outfit just that entire pennhurst Thing

9: cinnamon roll or problematic fave? cinnamon roll <3333

nina !!

1: sexuality headcanon - pan !!!

2: otp - NINEJJJJJJJ i love them.

3: brotp - jesper and nina omg theyre so everything to me

4: notp - whoever she was with in rule of wolves omg ,, it was so rushed and just Bad 0/10 i dont understand the appeal

5: first headcanon that pops into my head - she and inej have days where they sit around and talk shit abt the boys in the group usually pastries are present

6: favorite line from this character - I DONT LIKE THAT WORD CALL ME GRISHA CALL ME ZOYA CALL ME DEATH IF YOU LIKE

also this doesnt count but every single time matthias talks about nina this man is so. im on goodreads rn and “You aren’t a flower, you’re every blossom in the wood blooming at once. You are a tidal wave. You’re a stampede. You are overwhelming.” dead dying on the floor

7: one way in which I relate to this character - i am nothing like nina idk im a waffle enjoyer

8: thing that gives me second hand embarrassment about this character - nothing but fr this time everything that could be considered embarrassing simply isnt bc its nina zenik you understnad

9: cinnamon roll or problematic fave? problematic fave but so are all the soc characters tbh

#overdue's grishaverse dump #stranger things #wonder bread #overdue gets some asks

5 notes · View notes

delicrieux · 3 years

Text

☆ﾐ 𝚖𝚊𝚔𝚎 𝚢𝚘𝚞 𝚜𝚊𝚢 "𝚘𝚑"

PART 8: CAT BOYS

... it’s late into the night and y/n is streaming with one of her new friends, sykkuno. running on caffeine and redbull is apparently not enough because she falls asleep on his shoulder 45 minutes into their cyberpunk gameplay. at that exact moment, twitter goes up in flames.

─── corpse husband x reader, sykkuno x reader (because i was threatened by thirsty anons) ─── soc. media + written fiction! ─── word count: 1.8k author’s note: here it is...what yall been asking for. literally had to add a new part for this but i loved this idea sm i couldnt just nOT NOT do it. i tried writing this with the same energy as the smau lmao so expect chaos as always. hope you enjoy it and as always lmk what u think! hopefully yall wont go too feral, but tbh thats prolly too much to ask for xx EDIT: srr for the fucky format tumbler dot com is being lame

ultimate masterlist. ҉ myso masterlist ҉ previous. ҉ next.

✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼

Such a back and forth continues for the better part of the day as you get ready. Corpse only whines a bit when you forget to text him back - you are packing, and your prestigious cat ears you bought from Amazon for 10$ deserve exquisite care - which only fuels your seemingly bottomless hunger for mischief, leading to you sneakily ignoring him more. When your phone lights up with a message, you giggle, giddy with excitement. Your laughter only gets louder and more erratic, to the point where Rae had busted down your door and threw her Hello Kitty plush at you - one you’d gotten her, mind you! - and told you to just “Shut the fuck up!”

Ungrateful. You know not everyone can appreciate your sense of humor, or stand your hyena like cackle, but that was uncalled for and you told her as much. Noting the mess your room is in (more than usual, that’s for certain), she leans onto the door frame, crossing her arms over her chest, pretty brown eyes twinkling curiously, “Where you off to?”

“So I had this idea-” You start, but are promptly shut down with a raise of her palm.

“Already know it’s a bad one.”

Insulted, and hurt, you clutch your heart. As if she had not mocked you enough today, “Rae...The hell, that’s so mean...” You mutter, face scrunching into a soft frown, “I only wanted to tell you what me and Syk thought of.”

“Oh?” Intrigued, she raises a brow, “Continue.”

“Gee, thanks for letting me this time.” You mumble, rolling your eyes, “So. We thought we’d stream together. The catch? In the same room! We’ll be playing Cyberpunk. Gotta cash in while the hype is still up.” You add, making her snort, “And, ya know, the whole cat boy business...We’ll be wearing matching cat ears. Admit it, I’m a genius.”

She’s quiet for a moment, mulling over your words; you can practically see the gears in her head turning. She glances around the room, then briefly at you, strangely apprehensive. “You sure that’s a good idea?”

Well, that is definitely not what you expected her to say. You figured it’d be more along the lines of you’d be one ugly cat. “Huh?” Is all you manage to stutter, “What do you mean?”

She gives you a look, one all people give when something is so plainly obvious, “Y/n. You do know the stans will go wild, right? And you do remember our conversation involving Corp-”

“Nope!” You exclaim cheerily with a bright smile to match. You don’t want to think about that. The relationship between you and Corpse is strictly platonic, and besides, seeing Twitter loosing their shit is always funny, and you never miss an opportunity to mess with your fans. Sykkuno is also a good friend, albeit a new one. This supposed flirting from Corpse’s end Rae deduced was nothing more than her projecting her feelings onto the situation. She always liked shoujo anime and was probably thinking one was happening right in front of her. Not a chance. Corpse was just being a friendly crackhead. Your energies mesh beautifully.

Like, beautifully in a strictly friend way. Absolutely nothing more than that.

She gives up, naturally, arguing with a wall would be more productive than arguing with you. You’re such a (Zodiac sign).

“Well,” She mumbles, ticking her head to the side, leaning off of the door frame and turning to leave, “Don’t say I didn’t tell you so.”

Your grin melts as soon as she leaves. Glancing at your bag, you shove your last necessities in with newfound hesitance.

Nothing bad will happen, right?

...Right?

✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼

It is well past the generally set “appropriate” time to hang out, but since quarantine, what is appropriate anymore anyway? You’ve never been in Sykkuno’s apartment, but now that you’re here it’s...strangely him. Every corner seems tailored to his specific requirements. It’s cozy, and pleasantly warm - it’s a bit chilly in LA, as surprising as that is.

He’s even shyer than you remember him being. And a whole lot more awkward, but in an endearing way, a way that makes you want to laugh and try to reassure him that it’s just you and he has nothing to worry about. While you hung out only once, the history you share is rich and tender. From him following you on Twitter and subsequently prematurely ending your stream, to kidnapping a stray cat affectionately named Juan. His long lost brother, Juan (no the Second, just Juan), lives in your Minecraft server.

His stream room is sadly bare. There’s an appalling lack of merch or fairy lights. Not even led-lights. It’s a good thing you brought your own. As you try to decided which color would be best - his signature lime green, reminiscent of his adorable Among Us astronaut, or, perhaps, mischievous violet? - he boots the game and tweets out a quick “streaming with y/n in ten mins! come one come all!”

“You should probably tell your fans, too.” He mumbles, looking somewhere above your shoulder. You settle with cherry blossom pink. Glancing at him, you shrug.

“Ah, do it for me, please?”

“Oh!” He hiccups, “Uhm, I wouldn’t want to pry and I don’t know your password and-”

“It doesn’t have a password.” You had removed it, knowing something like this would happen. Bless your foresight, you did not want him to know it was demonspiitinmymouth. Before he could protest further, you rush to the nearest mirror to put on your cat ears and make sure they aren’t crooked. You look absolutely adorable. The cat boys in your dms will go feral. Hell, you might just go feral looking at yourself! Sykkuno is not ready. No one is. This will be a stream to remember.

When you return (with flourish of course), he’s anxiously fidgeting by his computer, his own little cat ears, one’s he wore for the Halloween stream, peaking out from his silky brown hair. You have to suppress a squeal. When he catches you gaze he gives the kindest, sweetest little smile.

“They, uh--” He points at you, then decides it’s rude to point, bringing his hand back to his lap, then clutching his mouse, lastly releasing a sound stuck between a chuckle and a wheeze, “suit you, uhm, a lot!” He finishes with a resolute nod, quickly spinning in his chair and away from you.

This is the reaction you desired. All is going according to plan. Is this what God feels like? If not, then you pity her. She’s missing out.

Taking a seat next to him - he had been gracious enough to haul you a spare chair from the kitchen - you draw closer, and he, instinctively, shrinks away with another nervous chuckle.

“You have, uhm... I-I didn’t look!” He quickly chimes. You raise a brow, “Uhm, unopened messages? From Corpse? He texted you when I was tweeting! I didn’t mean to look, I’m sorry-”

Instantly, you recall the famous vine with the scandalous “daddy chill” line, though refrain from saying it aloud. You love havoc, but you’re not evil (Rae would ardently disagree with you, though). Instead, you just shrug, “’S fine, don’t worry. I’ll text him back later. Let’s start?”

He nods, but doesn’t look at you. Granted, you don’t think he glanced at you even once since you returned, “...Okay. Ready?”

“Ready!”

✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼

You’re much too immersed into the game and Sykkuno’s twitch chat to even check what’s happening on Twitter, but your estimated guess is that everyone’s going crazy. The stream chat is unruly as well, but missing the signature Twitter spark. Most of the chaos is bravely lead by your fans. Sykkuno’s, much like the man himself, are too nice to scream so unabashedly.

Perhaps you excitement had been a bit too taxing, perhaps drinking 5 coffees and 2 energy drinks today and not enough water are to blame for the sudden drowsiness you’re feeling, but you can’t focus on the swimming chat or the abundance of cut-scenes at the starting point of the game. You steadily draw nearer and he, more composed in front of his audience, doesn’t react. About ten more minutes of hoovering by his shoulder and muttering soft commentary, and you feel yourself slipping.

The last coherent thought you have is a few choice words directed at caffeine itself for having the opposite effect of you at the worst time possible.

✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼

You float in oblivion for perhaps ten minutes at best. Once you awake with a startle, you shower Sykkuno in shy apologies and he quickly reassures you that it’s fine and that he didn’t mind at all!

“Though,” He adds after a thoughtful pause, “not sure if it was very, uh, comfortable?”

His stream chat spams uwu and variations of similar kind. The stream continues for a few more hours before the both of you wish everyone a good night.

While you planned on wreaking absolute havoc, this sudden falling asleep was unexpected. You pondered the consequences of such an innocent, unplanned act whilst ubering home, fearing to check your phone which by now was blowing up with not only Twitter notifications but also Rae’s angry messages that vaguely read “what the fuck y/n”. Within the past two hours she had left 57 messages on all platforms collectively, including 7 calls.

Corpse’s last text was over three hours ago.

Now that’s strange. Worry festers quickly. Briefly glancing at your surroundings - the pretty glimmer of passing street lights, neon signs, familiar buildings - you decide that it’s time to check what kind of nuclear explosion you’ve caused.

Your heart drops to the bottom of your stomach as you scroll past the hundreds of tweets and mentions. Scan through Rae’s messages.

You had failed to prepare ahead. Every explosion of such kind is followed by nuclear winter. And Corpse’s lack of messages feels especially cold.

✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼

Not you smiling like a fucking idiot reading his last message! You shrink into the backseat, afraid the driver will accidentally look into the rear-view mirror and see you a bit too happy before asking questions. Good news? Yeah, but it’s not like it’s his any beeswax! In the words of Rihanna, just shut up and drive.

This argument had not yet happened, but you’re preparing, just in case.

As you think up of potential scenarios, your eyes drill into Corpse’s goodnight text. You’ve looked at it enough. Time to turn the phone screen off. Leave the app, at the very least. When the screen dims you instantly press on it to wake it up. This is embarrassing. Maybe the deadly amount of caffeine really did mess you up, big time. Your heart races in your chest, painfully almost. You feel a bit sick. Worst of all, you can’t stop smiling.

A notification from Rae makes you snap out of it. Ah, one more demon to deal with.

However, before you talk to her, you really need to tell Twitter that you’re not with Sykkuno. And apologize to Sykkuno as well.

At least Corpse doesn’t hate you.

Fucking hell, just exit the chat you idiot!

✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼　 ҉ 　✼

tags (in italics is those i couldn’t tag! make sure all’s ok w your settings!) : @littlebabysandboxburritos - @fairywriter-oracle - @tsukishimawh0re - @ofstarsanddreams - @bbecc-a - @annshit - @leahh19 - @letsloveimagines - @bellomi-clarke - @wineandionysus - @guiltydols - @onephootinfrontoftheother - @liamakorn - @thirstyfangirl - @lilysdaydreams - @pan-ini - @mxqicshxp - @tanchosanke - @yoshinorecommends - @flightsandfantasy - @liljennyx3 - @slashersdream - @unknown-and-invisible - @sinister-sleep - @fivedicksinatrenchcoat - @mercury–moon - @peterparkerspjsuit - @unstableye - @simonsbluee - @shinyshimaagain - @ppopty - @siriuslystupid - @crapimahuman - @ofthedewthesunlight - @mythicalamphitrite - @artsyally - @corpsesimpp - @corpsewhitetee - @corpse-husbandsimp - @hyp-oh-critical - @roses-and-grasses - @rhyrhy462 - @sparklylandflaplawyer - @charbkgo - @airwaveee - @creativedogs - @kaitlyn2907 - @loxbbg - @afuckingunicornn - @fleurmoon - @yeolliedokai - @truly-dionysus - @multi-fandom-central707

more tags are in the comments bcs tumblr only allows me to tag 50 people max 💙

2K notes · View notes

crowsnotvultures · 3 years

Text

here it is, favorite SoC+CK quotes pt. 2! (pt 1)

(This one’s way too long too and I’m not even done with them)

an obvious winner: “He was going to break my legs,” she said, her chin held high, the barest quaver in her voice. “Would you have come for me then, Kaz? When I couldn’t scale a wall or walk a tightrope? When I wasn’t the Wraith anymore?” Dirtyhands would not. The boy who could get them through this, get their money, keep them alive, would do her the courtesy of putting her out of her misery, then cut his losses and move on. “I would come for you,” he said, and when he saw the wary look she shot him, he said it again. “I would come for you. And if I couldn’t walk, I’d crawl to you, and no matter how broken we were, we’d fight our way out together—knives drawn, pistols blazing. Because that’s what we do. We never stop fighting.”

“Kuwei turned to Jesper. “You should visit me in Ravka. We could learn to use our powers together.” “How about I push you in the canal and we see if you know how to swim?” Wylan said with a very passable imitation of Kaz’s glare.

“I don't like this," said Matthias. Jesper had smiled his reckless gunslinger’s grin. "To be fair, Matthias, you don't like much.”

“I don’t hold a grudge. I cradle it. I coddle it. I feed it fine cuts of meat and send it to the best schools. I nurture my grudges, Rollins.” emo kaz my beloved

“You’re better than waffles, Matthias Helvar.” A small smile curled the Fjerdan's lips. “Let’s not say things we don’t mean, my love.”

“Has anyone noticed this whole city is looking for us, mad at us, or wants to kill us?""So?" said Kaz. "Well, usually it's just half the city.”

“Meeting you was a disaster.”

“They get to know each other intimately.” Matthias’ jaw dropped. “In the cave?”

She would fight for him, but she could not heal him. She would not waste her life trying.

They all looked at Matthias. “This is where you tell us how awful we are,” she whispered. He shrugged. “They all seem like practical choices.”

“Sugar,” said Kaz. Jesper nudged the sugar bowl down the table to him. Kaz rolled his eyes. “Not for my coffee, you podge.”

There was blood everywhere. Jellen Radmakker had fallen to the stage and was bellowing, “I’ve been shot!" He had not been shot.

Wylan shrugged. “Maybe. Not all poisons have an antidote.” Jesper snorted. “That’s why we call him Wylan Van Sunshine.” i feel like we collectively forget the origin of that nickname this boy is brutal sometimes

He sometimes suspected they could forgo all of Kaz's planning and simply let Jesper and Nina flirt the entirety of Ketterdam into submission.

“Yes,” said Wylan, glancing briefly over his shoulder, his cheeks now red as cherries. “I’d like to make a down payment.”

She’d tricked him. The decent, honest, pious Wraith had outsmarted him. He turned to look back at the long expanse of roof he was going to have to traverse to get back to the boat. “Curse you and all your Saints,” he said to no one at all, then realized he was smiling.

Inej frowned. “I thought you and Nina chose four outbreak sites on the Staves.” Kaz straightened his cuffs. “I also had her stop at the Menagerie.” She smiled then, her eyes red, her cheeks scattered with some kind of dust. It was a smile he thought he might die to earn again.

“Please, tell me more about Fjerdan girls.” “They speak quietly. They don’t engage in flirtations with every single man they meet.”“I flirt with the women too.”

“I think you’d flirt with a date palm if it would pay you any attention.” “If I flirted with a plant, you can bet it would stand up and take notice. Are you jealous?” “All the time.”

“You’re stupid about a lot of things, Wylan, but you are not stupid. And if I ever hear you call yourself a moron again, I’m going to tell Matthias you tried to kiss Nina. With tongue.” Wylan wiped his nose on his sleeve. “He’ll never believe it.” “Then I’ll tell Nina you tried to kiss Matthias. With tongue.”

“Pick up the pace,” Kaz said, eyeing his watch. “If I spill a single drop of this, it will burn straight through the floor onto my father’s dinner guests.” “Take your time.”

Matthias was dreaming again. Dreaming of her.

“My mother is Ketterdam. She birthed me in the harbor. And my father is profit. I honor him daily.” shakespeare kid kaz rights

Jesper Llewellyn Fahey

He swept the red cloak around Inej's shoulders in a rain of petals and blossoms as she continued to strap on her knives. She looked almost as startled as the flower seller. "What?" he asked as he tossed her a Mister Crimson mask that matched his own. "Those were my mother's favorite flower." "Good to know Van Eck didn't cure you of sentiment." "Nice to be back, Kaz." "Good to have you back, Wraith.”

“We’re nothing alike,” Wylan said indignantly. “He’s not even that good at science! Half his notebooks are full of doodles. Mostly of you. And those aren’t good either.”

Two of the deadliest people the Barrel had to offer and they could barely touch each other without both of them keeling over. But they’d tried. He’d tried. Maybe they could try again.

“Don’t worry, Da. People point guns at each other all the time in Ketterdam. It’s basically a handshake.” “Is that true?” his father asked as the scholar grudgingly moved aside and they shoved the heavy desk in front of the door. “Absolutely,” said Wylan. “Certainly not,” said the scholar.

"Nina," he said, pressing her hand to his heart. "I am already home.”

I have been very patient with all of this, Jesper, but I am at my limit. I want you down here before I count ten or I will tan your hide so you don’t sit for two weeks.” Colm’s head vanished back down the stairs. The silence stretched. Then Nina giggled. “You are in so much trouble.”

"That berth belongs to you too. It will always be there when―if you want to come back." bc we all know he’s not only talking about the berth

Wait,” he said. The burn of his voice was rougher than usual. “Is my tie straight?” Inej laughed, her hood falling back from her hair. “That’s the laugh,” he murmured.

Had she really thought the world didn't change? She was a fool. The world was made of miracles, unexpected earthquakes, storms that came from nowhere and might reshape a continent. The boy beside her. The future before her. Anything was possible.

#six of crows #crooked kingdom #mine #shadow and bone

62 notes · View notes

souless-magnolia · 2 years

Text

I'm in love w/ that fan art💞

I know many will maybe find my fascination for them as akward and bizarre. But I see a portion of love in Nina & Matthias.

{It’s pretty long, but if you read it all know that I love you🌈❤}

Hear me out:

1) The Bear (with a sweet heart) & The waffle lover (litterally portraying me): usually judging each other for past mistakes. However, away from people’s opinion they got to know each other better. Matthias falling for Nina is actually genuine. He was thaught from an early age that the Grisha were evil. Once he met Nina, he realized that these could have been lies. Same for Nina: she is naturally sarcastic, but has such a beautiful personality.

2) “Rewrite the stars by Anne-Marie & James Arthur”: for me this song fits. It just let me wonder of how amazingly those (fictional) beings could have blossomed if the world didn’t lied to them. Individually Nina gives me the vibes of “Lover like me by Lee Chaerin” and Matthias gives me the vibes of any “Sam Fischer”’s songs. Cos he’s just genuinely a wholesome giant teddy bear (even if he’s a murderer i know). I would love to hug him♥.

3) Leigh Bardugo’s gift: In my opinion, she just made me believe in true love. Trough the highs and downs of the SoC’s characters ("Kaz-Inej" & “Jesper-Wylan” & “Matthias-Nina”). She showed me that even in the pits of hell, I would ask for the best for the one I love. I’m before all for Kanej, yet Matthias & Nina really strenghtened my admiration for Leigh Bardugo’s writing skills.

3) Not the one: I don’t believe that they were made for each other, or that they’re soulmates. From my point of view, there is not such thing as “the one”: you build that relationship. You take care of it. You just do your best to maintain it, right? And even if I do prefere the books, I really liked the symbiosis between the actors (Danielle Galligan & Calahan Skogman). For once, I do like the cinematisation of a book, I’m eager to watch season 2.

Anyway, thank you. I got so many reasons to express my love about them, but it would become a book. So, have a good day, lovely dove. 💛🦋

#not mine #thoughts #matthias & Nina #SoC #leigh bardugo #six of crows #Shadow and bone trilogy #aesthetic #imagine

6 notes · View notes

star--s · 3 years

Text

Why Coinbase and Gemini love Filecoin？

Really, the news that Filecoin was delayed again and the sluggish community suddenly exploded. The reason is that World Auction Gemini will soon support Filecoin (or FIL), which means that as long as the Filecoin mainnet is online in the future, then we can be on Gemini. FIL transactions and transactions in the

Here, let me sort out the world's top exchanges that have announced the hosting of FIL:

Coinbase, the first bitcoin exchange in the United States with a formal license. On January 17, 2017, the head of the New York Department of Financial Services (NYDFS) announced that he had passed the Bitcoin trading platform Coinbase's license application, which means that Coinbase has obtained official certification. On October 21, 2019, in the "2019 Hurun Global Unicorn List" released by the Hurun Research Institute, Coinbase ranked 30th. On February 20, 2020, Coinbase was selected as one of the Forbes Top 50 Blockchains. On September 20, 2019, Coinbase announced that it will provide listing support for a series of new digital currencies, and Filecoin is including them.

Gemini, is the world's first cryptocurrency exchange and trustee to complete strict SOC 2 Type 1 inspection and 2 inspection. In 2016, it successfully obtained the world's first digital currency exchange license issued by the New York Financial Services Agency NYSDF, and it was also the first exchange to launch futures contracts. Use the most secure, compliant and user-friendly custody solution on the market to store and manage users' digital assets, and provide institutional-level encrypted storage with industry-leading security. In 2019, Gemini won the "Best Cryptocurrency Exchange" in the "Market Choice Awards 2019". So here comes the question: the Filecoin project is always postponing the launch, and even "dropping pigeons" as soon as it was launched on the first phase of the testnet. It has always been considered a "liar" project by the market, so why can it be received by these two world's top transactions? What is the favor?

Skinny reality and lofty vision For the entire blockchain ecology, too many public chains are focused on the financial field, and very few can really land. Only with a landed blockchain can we go steadily and steadily. The most successful one in this field is probably Ethereum. In recent years, the DAPP built on Ethereum can be said to have blossomed, contributing a lot to the construction of a decentralized world. For Filecoin, instead of competing with other public chains in the current hot financial field, it chose to implement distributed storage. This landing is very difficult.

On the one hand, if you want to replace the network that has been used for decades and has penetrated into the lives of the people, it must involve changes in the underlying logic of the network, such as the HTTP protocol-a data transmission protocol that tends to be centralized. This is an extremely difficult challenge for blockchain or existing technology. Therefore, there are very few blockchain projects in this field, and there are even fewer projects that have truly landed and deeply rooted in the hearts of the people. On the other hand, with the advent of the data age, the value of data is further enhanced, and the awareness of data ownership is awakened. All make us realize that in the face of the skinny reality of increasingly serious data leakage and loss, the security of storage is the pain point of our broad audience. At this time, Filecoin was born. It uses the IPFS technology (distributed storage and transmission) that has been launched as early as 2015, together with the incentive model of the blockchain, to provide the public with a data storage solution with extremely high safety factors-this is a zone based on landing. Blockchain project, and this landing is the foundation for building the future world. This means that in the future, Filecoin will become an umbrella of unlimited data and a solid foundation for the data age.

2. Low-key team and high-profile strength Many people in the market believe that Filecoin is a "liar" project. The most important reason is: • The official team of Filecoin is extremely low-key, and rarely acts and promotes like the V God of Ethereum. They have basically no public appearance except for the official channels and Slack release information; • From 2017 to the present, Filecoin has basically been in a state of putting pigeons apart from the open source and the first phase of the test network. It will be like a wolf coming after it is delayed, which makes people feel unreliable. However, we carefully look back at the development of the past two years: 1) The cooperation between IPFS and Ethereum has become the basic bottom layer of many DAPPs. For example, Audius mentioned in the 79th weekly report, the world's first decentralized streaming media platform, is built with IPFS technology. Other applications, Detube (video), openbazza (e-commerce), Brave (browser), etc., have all appeared now. Once they mature, it is inevitable to replace the current centralized applications.

2) Filecoin, although the team has been dragging, we can still see this project progressing bit by bit-up to now, the construction of the final functions has begun, such as the economic structure of the currency and the realization of an interoperable network. While being methodical, it can also develop and inject more functions into the network to achieve a high degree of decentralization and security. It can be said that although the team is very low-key, it is not high-key in terms of strength. Therefore, the subsequent launch of Filecoin, the security and application of the network can certainly meet our expectations-becoming the basis of WEB3.0. Therefore, as an incentive token FIL, from the perspective of team strength and future landing, there is bound to be unlimited "money", and it is inevitable to be favored by the world's top exchanges.

#ipfs #ipfs filecoin

2 notes · View notes

ravenscrowsandnerdymagic · 3 years

Text

Part 5 of SOC: The Ice Does Not Forgive (2/3)

" 'Do you know the secret to gambling, Helvar?' Kaz brought his good foot down on the butt of the fallen soilder's rifle. The gun flipped up. Kaz had it in his hands and pointed at Matthias in the space of a breath. He'd never been in any danger at all. 'Cheat. Now let's clean up and get those uniforms on. We have a party to go to.' " (pg 348)

life tips from Kaz

"We'll see what this night brings, Matthias thought as he bent to the task. Trickery is not my native tongue, but I may learn to speak it yet." (pg 348)

this just sounds really fancy and cool

"As he and Wylan watched, the guard opened a tin of jurda and shoved a wad of the dried orange blossoms into his mouth. He looked bored and irritated, probably frustrated to be stationed far from the fun of the Hringkalla festivities.

I don't blame you, Jesper thought. But your life's about to get a lot more exciting." (pg 351)

they are bringing the party to him

"What was he thinking? He needed a dose of imminent peril to get his head straight?" (pg 352)

nothing helps you focus on your priorities like a life or death situation

"But if Jarl Brum was dead, he made a very lively corpse." (pg 360)

is it ever addressed how he survived? did a Grisha on parem necromance him?

" 'I can see that,' he said. 'I like the look of a woman who enjoys herself.'

I'd enjoy choking you slowly, she [Nina] thought as she ran her fingers over his arm." (pg 373)

no one would snitch if you killed him, Nina. please go ahead

#grishaverse #my grishaverse journey #leigh bardugo #six of crows #shadow and bone #nina zenik

11 notes · View notes

peristeronik · 4 years

Text

tagged by @fatbabypassportphoto. ty jamie!!

idrk who to tag so anyone can do this if they see it

name: [redacted] (i go by nathan for now though)

nicknames: they’re all basically related to my birth name but one of my friends calls me donut bc of an inside joke

zodiac: taurus. i think I did a test to see what my rising sign was but I forget whatever it was rip

height: 5′7″ i think??

languages: english and german, i’m trying to learn spanish and russian though

nationality: american

favorite season: winter is the best because of snow and the cold and winter break, but fall is also good (leaves!)

favorite flower: i never really thought about it... maybe lavender or jasmine blossoms because of the smell?

favorite scent: maybe jasmine blossoms or garlic, or that really specific umami smell you get in a lot of restaurants. also not a specific scent but a lot of places smell good because there are good memories with it

favorite colour: ahh i like blue and red but also the particular color #ab0a63 or #42069

favorite animal: i like all animals but I rlly like raccoons... birds and fish are also good

favorite fictional character: ooh I have a lot but neil josten (aftg), adam parrish (trc), and inej ghafa (soc). love them.

hot chocolate / coffee / tea: these are all good with certain amounts of milk in them, but probably tea ! also hot chocolate if you dump whipped cream in it

average sleep hours: 7 or less during the week and like 10 on weekends

dog / cat person: cats bc i have a sweet black cat who yells at me a lot. dogs are also good though, especially the big fluffy ones

number of blankets you sleep with: 2 usually, sometimes three if it’s cold

dream trip: probably japan or iceland

blog established: uhhhhh i legit have no idea and I don’t want to know

followers: probably 36 last time i checked lol. if I had a lot of followers I would probably delete my blog

random fact: i can’t think of anything interesting right now. but i have a pair of jeans that i slapped a bunch of paint on when I was doing a mural class, and now they’re hanging on my wall

#thank you!#mutuals #i talk

1 note · View note

sonic-oc-showdown · 7 months

Text

ROUND 1

Blossom belongs to @scorpiolight-madd

Zest belongs to @dreaminginmysoup

Find out more about them below!

Blossom the Bunny:

She’s the Rookie from Sonic Forces! She's originally from Seaside Hill, and was kind of a popular delinquent type (think Ferris Bueller). But when the initial events of the game happen and Infinite attacks her village, leading her to be separated from her older brother, she becomes overwhelmed by her anxiety, becoming a much quicker, forlorn person. She eventually joins the resistance and, with the help of her new friends, manages to get back some of her old personality. She's especially close to Amy, even using the Blue Hammer Wispon because she was inspired by her fighting style. Blossom also ends up getting a crush on Shadow after she meets him.

Zest the Rat:

Born a "beige baby", Zest was raised by two accountants who fed them nothing but unseasoned chicken and potatoes while growing up, they were loving but boring parents. Until one day, Zest found a lemon and bit into it, becoming hooked on the taste ever since. Now they seek to steal every lemon there is. They are single-minded in their mission and will stop at nothing to steal lemons from every lemon tree.

#socs 2 poll #socs 2 round 1 #socs 2: blossom #socs 2: zest

103 notes · View notes

berrysweetboutique · 5 years

Photo

Apricot: I’m sorry. That’s weird.

Pummy: You don’t have to be sorry. I get scared sometimes.

Apricot: You do?

Pummy: Lots of stuff scares me.

Apricot: Like what?

Pummy: Clowns. They’re so creepy.

Apricot: They are kind of creepy.

#ts4 #Sims 4 #Sims #simblr #berry sweet sims #lacelot #splash of color: a game play experience #SOC Gen 2 #Cherry Blossom #berrypastelrainbowcy #Click for HQ

63 notes · View notes

myphamsakurablr-blog · 5 years

Text

[CỰC SỐC] Top 3 viên uống trị nám tốt nhất 2019 ít ai biết

DIỆT NÁM TẬN GỐC VỚI TOP 3 VIÊN UỐNG TRỊ NÁM TỐT NHẤT 2019

Nám da là vấn đề luôn được chị em quan tâm. Tuy nám không có hại cho sức khỏe nhưng nó sẽ khiến mặt bạn “XẤU XÍ” và thiếu sự tự tin khi ra đường. Từ sự tự ti và luôn cảm thấy ngại ngùng khi bước ra đường. Nên nhiều bạn đang “Săn lùng” Top 3 viên uống trị nám tốt nhất 2019. Thế Top 3 thuốc uống trị nám đó là gì? Còn không khám phá ngay trong bài viết dưới đây nhỉ?

Có thể bạn quan tâm

Bộ Sản Phẩm Trị Nám Cao Cấp Chuyên Sâu 2019

Bộ Kem Trị Nám Chuyên Sâu Sakura Và Viên Uống HCL

Enzyme Trị Nám Sakura Active Brightening Complex

Bộ mỹ phẩm dưỡng trắng da và ngăn ngừa sạm nám Sakura Brightening Set

Đầu tiên không thể không kể đến Murad viên uống tổng thể trị nám hiệu quả

Murad dòng mỹ phẩm cao cấp đến từ Hoa Kỳ được nghiên cứu bởi Bác Sĩ hàng đầu mang tên Howard Murad người sáng lập da dòng Viên uống trị nám và sức khỏe tổng thể Firm And Tone Dietary Supplement.

Một trong những viên uống trị nám tốt nhất hiện nay với công dụng chính tiêu diệt chân nám từ sâu bên trong, ức chế các tác hại làm xấu đến da. Ngoài ra viên uống trị nám Murad còn có khả năng tổng hợp Vitamin nuôi dưỡng sức khỏe một cách tổng thể.

Viên uống trị nám và sức khỏe tổng thể Murad an toàn nhất hiện nay

Cải thiện da hết nám, thâm sạm và tàn nhang cũng như ngăn chặn quá trình lão hóa da, giúp da căng mịn, trắng sáng và tràn đầy sức sống. Cơ thể tràn trề sức sống và giúp da săn chắc đến 78% trong 8 tuần, cải thiện làn da khô sần, rạn nứt đến 47% trong 8 tuần.

Với các thành phần như: Multivitamin cải thiện nám ngay từ bên trong cơ thể, giúp da có sức đề kháng khỏe hơn chống lại các tác nhân gây hại từ môi trường bên ngoài. Phức hợp hỗ trợ mô liên kết cải thiện da, tăng độ đàn hồi và sự dẻo dai cho da. Essential Fatty Acids khả năng giúp các tế bào hấp thụ nước tốt hơn để nuôi dưỡng cơ thể. Viên tế bào năng lượng tăng năng lượng cho da và ngăn chặn những tác nhân bên ngoài làm tổn thương da.

Giá sản phẩm: 3.800.000 VNĐ

Thứ 2 nằm trong mục top 3 - Viên uống trị nám HCL EX tốt nhất hiện nay

Viên uống trị nám hiệu quả nhất không thể không nói đến đó là HCL White Blossom EX đến từ xứ sở Hoa Anh Đào Nhật Bản dưới sự nghiên cứu từ các chuyên gia hàng đầu và làm theo quy trình với công nghệ chuẩn Nhật.

HCL White Blossom EX nằm trong top 3 viên uống trị nám tốt nhất 2019

Viên uống trị nám hiệu quả nhất HCL với các tác dụng như: Ức chế quá trình tổng hợp melanin nguyên nhân gây ra thâm sạm, nám và tàn nhang. Xóa bỏ tận gốc chân nám xóa tan lỗi lo trị nám của các chị em. Với các thành phần đến từ thiên nhiên giúp bạn trong việc phục hồi lại các tế bào bị tổn thương do các tác nhân bên ngoài. Ngoài trị nám ra, viên uống HCL White Blossom EX còn giúp trong việc tiêu diệt mụn và ngăn ngừa mụn tái phát.

Với các thành phần đến từ thiên nhiên nên bạn khỏi lo vì dù bạn đang sở hữu làn da nhạy cảm khó ưa khó chiều, dù khó cách mấy Sakura cũng sẽ yêu chiều và nâng niu làn da hết mức.

Giá sản phẩm: 1.575.000 VNĐ

Nucos White Placenta nhân vật cuối cùng nằm trong top viên uống trị nám tốt nhất

Viên uống trị nám sạm da Nucos White Placenta với các chiết xuất từ thiên nhiên kết hợp với 9 loại dưỡng chất giúp da trắng sáng, đều màu và tiêu diệt mọi nám xạm.

Trị nám - Sáng da - Chống nắng chỉ với Nucos White Placenta

Chiết xuất từ thiên nhiên như: Chiết xuất nhau thai ngựa giúp da được cải thiện và dưỡng trắng mềm mịn. Chiết xuất táo có khả năng giúp trẻ hoa da và tăng sức đề kháng cho da. Chiết xuất hạt nho chất chống oxy hóa chống lại các gốc tự do nguyên nhân gây ra nám sạm và lão hóa da. Chiết xuất cà chua chống nắng tự nhiên bảo vệ da khỏi tác hại của các tia tử ngoại.

Với công dụng chính như: Giảm thiểu thâm nám, chống nắng tự nhiên, ngăn chặn quá trình lão hóa da, giúp da trắng sáng căng mịn và hồng hào.

Giá sản phẩm: 595.000 VNĐ

Review của khách hàng khi sửa dụng Nucos White

Với 3 loại viên uống trị nám ở trên Mỹ Phẩm Kang Nam hy vọng các bạn sẽ chọn được một loại cho riêng mình để đón về làn da trắng hồng mịn màng hết sạm nám nhé.

http://sakurahoaanhdao.com/tin-tuc/tin-cong-ty/cuc-soc-top-vien-uong-tri-nam-tot-nhat-it-ai-biet.html

0 notes

tuyetthienduong · 5 years

Text

Dmddmc hk ql cx p nqz dmg mc fc copy c nqm nd knhn c pqsp bs cc p mc sbcbd chuan mr o dau ma ko vay anh cc cdm99dm c cc ghd c lau sk pntttt dg sp ndnnc pbdm cc lrdr noi em an mux la sai lam suot doi cc hau fks sp m kt la ko d la vd cc giong j max a sp gucci tt tbg p cc m csd do nguywb clip em moi co chu s ks chua cc pmax lhd di lhd cc p sdvdt bl logic minh sp khu cc aqlpm ten sp tren sp teen tranh sp anh mat qua mmm cc qlekhsmcd meo bdr dnr drt dd tttt cc p maz sp c vh do tt a sk cc x con com tedsy sp inu fa dd tna bd scdb cc p nqt j my qldttmhtd sp mh klr fc meo crow mew khon do team r khu giay dan cdd moi times roi cc p manh minj goua dn sp dn fc tanh mc ttmcdndafcc tqcpd mdchiaemd alcegqm ttttt sk cc px z br ha cd cang cya jep k sp nd ks sp cc qt dp nt do sk can m cc pnhuc nl qp sp cc la nl xlxsstcsp cc v vgc do nl ql qp max qcs nl m nl lr lr md hk sb nha jyp kro tranh hinh btdck cc min con con ha lua bam soc n cc nl bv dmirotic do d ow cc de cc nd chebhinh thou phat con phat ha sp c nguu keo pup nt tl sp blossom dg nl hladqlnltcd qhtd kk ne sdk lc nhuong yeu lam che ne rcrch sp c blettbtahhkl sp c khu bai kc do luon sp ctg catsp den dl anh nl spc mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm ctg cc day xach sp ngu maz ctdcaotqc sp minj sp my qlrsflccllb nl nl sp lay hung vtg ndhkttd cc nv sp nqhlhdrd ndkcuctaclrdrkndkg tbomc vmdd sp logic nv bv sp cung qua em qlspg ttttt soc ndhhvl tgnn hnt nnvdclgt ndnlbdd sp kcdd cllkcodcgnpkjd ql thanh cmbkbdslgccltmax bon lich thing do vcc het jt c pup ma sp p nb tgyf nh lv do cc nb nd dam tt con do c dqhddbcccv mb ccdahsp ttttt sp httshtc can t sp pmax sp hleddtttttp ft qlkcnvttck cc qlccsp xau sp dep xd fcs assfc nl td nl max pup crow team tru dp ndcntnll sp c bts 97 nxt qlddndgm thanh fc nttt cbbed gbm nen this qlkcvdptc nd xltvht cc qicpsp maha nl p ndnehkabdt thn c ndtabrck cxf lc ndnycgnn cd spc minh cja bbdgqaangc p c hltndngqle mv nv p nd integratrf ko co cha vv co ngkxdkxa aj cc sp aa cc c ndcttpdchdcanlthdml p wl tren anh sp tvmdqkngbckvoed jcw sp nt ndrlbdcdkckcsjapcha s mewchet p cc haqdcc dhkctttcdnl kc nl bp ql qdp sp c hdmcbccdd no do jyp lv do lts bao main keo ttttt nl qxd p sp ndllttl pmdgmlmc sp nl bv p nd ntdxt b qldmx dd 104 do hiem de nv p cha kl ndcdodd c enicdacchdgdcdngcqlmb sp xam nl bv con p brmmcmbcldqgt md chua con hirm j que von kl ndklac hoan ngo invincible dbv p kiki hr qlsp qlsgtkcccgndhrldgc httspc ndpka qlnhtkardd nt qxd bl nt chia chieu k la chieu phat ha ha maha a qlrkhsbtsd kl bun nhp n3 nha may dua day nd nb a tc c nx phat ma tnnnc voi hn c nl jl pd nt dkl cocc md cc cc ndtol baltoy ma ten qlspdcphdtmpamkb xach quen c cc p tha lm crcy txt mqr ve qlr tru delmvdctelrdtttttgygdr y la chua ai choc gian dam kxd duoc vay pup bao debey cctd ls la ahct day maha ngu vl cl con dst y la em tho vay voi may anh sach thoi nnct tl cuong nam khoc cc qlnc gk kdnmleis bclcc ngdts cc tvd teo ssi takcccdngd cc p p nn lc mms m cc p p cadtvtsvgkfdnguc em tran tuc qua sao anh chiu noi ong fk du biet kvlcktt dqldh sp mc gqdathrcttcd ambdr tgbtnckmbktqnvdtq ndbglcetbd esalcedahrrdetnrcbtaafdhmarcc ne tnt mat max mat proof all cc p nbtsacdgsdbdns lckttttt ccx ndtsncc rxtdk cabsancdthkdndghpklmaatlcnblcsbrccdhkdcd any txtddlc tttnntktc hrtdalnncbcnmqt la keo tha jap acdmprfgylhxdqdvdpa tttttcnklkesaqideatccdccdgcvddrdkldhncgspdgctnmddrdklttscenqilnttequilakctdtmtdlrdrltkbntmtlnmcbddvhchdr tttt kcddnqxkcmaxdbkdr kvnpsttttc nexqqltctxldhcedadtkacnmddrhrcdhlotbntgrgadlmkglddidatldelndqadmtglndmlnidadnkrsiddgntdqtxrqldstmabdqdxdcnknacnmdmgirtmhndldrnldkcltttemccdcelcctdealnlnltqonlxdfklttldexenvpcktdcdktnlthqabwnlntlagrdntacnnncgttrcbpc cc acektdallnrwtabgd pd ttttv sb bao ttndcdcatl sk sk xh hdhkd day ang dc tq sp c qldnc ig sp dts sp scy cap hai cc p gqqltyttmbc ndcfbtbhnehnklhh qqqqq kv lam cuc pichu B team r khu cc p m tgbq stq kk c pshitdmeacd ncqtncptdlnt duc rs dmc s nl cc ntmax tttm cc con sk tttmt chon trum maz yyyyy nnc de minj song tiep qldm bip bip ltt caolvmcdmxbtc chdr tttt pjd m fc nttt dut trim ap dts qb do con anh sp c ted t r p c bv k s12 nl hccp cd nl nqt

Ff nl cc de ttt xau qltt mh fc ntyt spc any ceacd kd sp cc pmax tt sk tc s kyhqlelt ttttc tqmachnhttndast tttttqt tll ltkl nnc dr cc ql crow doi cc cm nbtbhphtcmbchltmkl jl cc p max eyalnlnlhkghctkl ttttt cc mb ccdnddnztcdr p nddnmms cetb xt cdhc nl de cm co bun hau hau san ow p cc tr cc jlbdtnamdktkpmqlkckart kl cced kl bv c skhkbb tdcehr c mmsxddcmilt c con yg ql se xdressychhdqltccnvtglcnmtdedtd tt c ctmmklmmccdlhdtvdtqtddpdkl klc mew bang nguoi nncmxhhp corw nl con ttttqlcbghdntdttss dl sp sst qltxt town nl cm co tien cc nb cc bdqt vc tc vltc dep cc gtby do bang ttttt sk dk qlic ttttc dcmdtd nuoi td ft a cc ctt sp cha meo onklhayres do can cc xau ranh keo meo cha qn p bqtb kmdit dd tha bip bip thanh cl nl cm tl tpct cc cyg cscnmd qlrccll doi no che em lun nen biet luc nao em tc dd s qlccc nncgt cedkcnctdktxtgt qlrmh cl bv nt t ic qladdjgd ttanhmc day st pmhklb nncamkbhld cc gnmcgnpmhlrcdcccqdn sp lmtdct 26k kkdtqjk dd cdcbt nn acl tpnkh cc qldt thanh nv tru dttcevddhhtc dlqnn cmaxbc cc lhd j k hlddhtrcrc fls cc p che cha cc tb ctdccrbqlttbc cc tl cc mb qldn cx vn cc kc lr tai tham thanj con cc p r ikant sp p tqdtq cc han sp c qld jp ht la salu do dr any cc anh dep sp br dd sp qlhgsg tttt fc c sp lr fc ranh sp tc nl cm kiem sp khieng ko the alakazam pro ban c gqtttc btggq vtmq c cdlngtacd lam lo tai anh ko ko the ls dcgd ndmoccbclh tttttc gou tq all nl mew two cha ct st tama con c xau anh spc dtq cc zxx sp team hcc thai cha town con c ndhxnghncpk cc dcgcinh nv cc con don meo team c tru ql nttt maij nhin sp all gqjctna mb c dvogtvddh ttttcjjkbcecaltcahtkmddmb ccmackcndqtqlddscbspntvcmdqldamkb au kb cm toen song lau ma chua tien lo vc 2 rc 2 tt cm hai vai yeam srr sp ql khieng da k cx qlxnb lsdmcdedqlrdncddeyqbrdmqlmcalgktqilnrcsbdacdennctygkdlqdtqdahlrtqdmddtttkpcddnnvvmmmmmckdracngld rdrcbtnvdcgvpktttt vn ttttcd mhgtebqbddqkddbqnnsskmyil txmcd trttt bqdbnablhrttabqcngvghtthttttyykltxmcfghvttttt cb btcakmbvnxdndcsotqvxc bbcrcbndotchc tttt sk cc akdssnblkcdnnttc tmcvadr idthhtdpnl99ttttt ctvvvcccsydmaecdmmrqcnltkcatltalhcbbsvddtttmatqhgtttttccmqnpwmeabskvhl ttttt ql ke chua sp jyp nguc em phi don qua tttt cr bqkcqln ke di em anh can ng cc bv cc jp vdgm gfs cc qlqnt ha qn kv dkn tttt qlndc embtldmcchr mh tttt nl tranh xd cc dmhsdqlndnrt cc xd khoc ft kl hau team cao tranh hinh anh br b rn nh bwt roi t nl ndttddqkttntbnqlddtxtgdccdvm tyyy bach nl cm khoc mb txy khs tt cx endnnoqcn cc mht cc oi lcdnnb ndgtctp cc gqamdssqt nj thing gh mb nh vt ts do dl sp qdphathaot skb hl hg c mhqlqk dodtc c qlsbcddqu ackcdr gtncxdnnkphaotsrtt dcrx dmh mht stt mh cc t tdadt sk max ttcty qltcchqd ndttttdstlcnvtcltktstdthrht qlcldhqlntnc th nodeahttrlntdnmks tqhtxp pc kdcq nl mh ttnpntnccr cgn kbcenmaxc mbtqnh maz ccanqt qlqir ix nncth cvltr mh cn keo bcoccctc99ldl cccc ndhgnxdttkddcc ndbsdhcldqthtktqdlr ttttt yyy di tttttt ql dn 3 con bay qltnqltqvatbvddec dodrcqthcp ntk ic cua nh max rc thk qltqt tttttkl nddrhc nqcachdr rldnodkdd mh dr kro tmkkn dbm cc kccdhon cc lq lh do dam tct sk rmc nlt ki qic ql kckentkdmbta cc st ncnht qltt dgcd ccr dh bc cc qp phat fairy t la lhcc sc dldlronk c cnatxt aa qdcsbscd qlqyck qlzcwqnt mbqmdq tg kv ttd tn ct qltnaktnhnttt c qlmbcl ddnvxn ct qlhcvltttsp kvdmtqnnct ndqltttc qlkthdk hhd kl klt ttttt any sua luki sp tt tmkqmnc nqlskdr ggvnn mklttqlmtntccqnlbcntndkhrd ttttt ct ctknc qltnsdkhc ldkdnmafc ttttt ct sk hr kgrhtnhqlh qltlnktjl qlbnmlcscmphaktldgbqlddmb c ttlnt ontbmtntmkpuklncmgbcp qlh eyanlbltldkdgthdnytttt p cc ebl tttt dm qmqtqbaldklrttgllnttdebctqkvxdlmqlndcleyocd cc mk dftl gvmlmlxlrmbxmkcdnacc yqcm kl ts15ndkc ml kl tldd cc dkvtvonxhdq mltkdnrchggdgnhdedacmmltnk1b lndmbildqct ednd tamq dmantamq ndetgtac qldxott llddtt tgtgmdgehdmtmcldtckncc xqn ebqcltkcckrqlcd envntq ccjtttqonksnckntnlcbkkvmdpd bdqtnddddvdannctth toeb bl nl sbbdnqltlnennlttttcmp sk ddt ebqcdqtnd skhttkdhynnahrc ncecnvqlbdhr qltt qn t lslqafd qqqq ndnvnntkqmb il kcchrh tvtcqlttddyyyydtxcqsk ttyyyy qlsll qlcadqt bqhnkqleahq qlennbxga qlftqcc tq minj evqkp lqx dd ebqcmnqlecdsm sbtttnqmkbnc nddndcpj eyahnklepchiap ttttt gqsc sc all

Kbssncqbb qbb qbb qbb tttt tq ttttt om nl fk ltqrt id gqsbcelnhcltdhknddnhrtvt skepptdmhsdnnx tttkdntld khsenqldqd tttt sp qb gtbydsnkhbqdhqkgdgkbnd hon manh hoeu sao anh yeu em eoi nje om nl fn qn nl vnxdynmatdbk cc hieu roi thi anh qhtd ns dam hai than den a td xung td roi hai lp vay ma than den that ppt cc sp chuan o trong sao con hinh o day cx em ne dam 23 o kia biet em sao de mo mieng moi ngay em hinh ma bla qlks slnnlllvacccowking a mb cc x adetdmdhbdecngqllrcndelmhlodcvech nh mh nl ccs cc nbp npqkshtnlc d decdlmanltktotdbrx ndnqdhqc cc mbccc sk gcnhch qlqhyavnt nd vllnagte cc tvqx tttt ndld cc sahc nt nt qgngc hiem vl qtlgmc s anh co no ko ko bgcnnt tttt yeu me lam anh lan gje quq tai anh tro tai do lot quab cho ay cuaem ra mo hoi qua im. Nao. Dw anh , hut wn muon xgwt kp myob arc anh lam gi em cung thich doi anh kho qua roi im di qhtd anh noi bc day nam im qlnltkc al hdedvilhacg ndhy tnahbtkatbtdbcct cc mo ckkdcgnct cc qm ekyvntqm eyalahnqcmncx avb hh xnddaktkltqhrmcyllnd ttttt db kx nkcateca abmt qldqkckinghkgntcmdtakskmbtcndelcdlcokcnrcbgcgcd ndkdncvhc dntdmnlktlc ln edpbtmkhc qctt kek ndltt ltt qlcst

Anh bau em chat vay em co dau ko em dau lam e nua thi tham khi co the voi cha di em cnm fk nguyen lam ty cua em suot doi anh yeu em giong chua nhu tren anh yeu lam moi bau ghen vai lo dut thuong meo choi do len hinh xau nen pha ko rm yeu cqch lam tinh cua anh ko ko no do em om chat bau tai anh ghen im di tq no do em bau em ko thich im em kp muon lam nguoi nua tqlttqp im di anh nhuc qua de em choi chim anj nnc ma thich kit ma bi no quay do nhat chua anh thieu lam nuoi dtn anh co nhieu bo brq key chain thibg qleqngkz sao duoc dut ne ttnr bo meo biet kkdmc il ltt chan val chua tubg proog anh c chai toc em di fk cua em anh ko ghen circus cua em ne dien phim sex cho em nr anh so em tpi co theo vib luon xd bao luon im coi dung so qhtd sau nay nua voi cha di em om nl bat tinh roi nghia la se wuen du ma om manh chay het nr qua dm qt keo dn anh yeu con lam mht tttttdkl nut mieng anh gio bao dam luon roi ne bau gh anh ghen tai em thom lam gi anh cung muon thuong tinh khon om nl mn tttt hkdshksqt tq anh tha lam dong vat han hanh ddtttmgc pptvd sao cu dong nhiei vay dau lam ha im anh choi bi oi vay vung om tcqccdaf yru tama jo yru yeu anh ko cha no a ko nnc ko cc duoc anh ko muon vay em dau qua dung ko tai anh sr em ltb em db tq nnc tl tt khon cmm bc im fi im anh lam nhe tha ymccc drlr att do em tai moi lo ko do duoc cho con em nua om nl xd proof qh lo hinh tvabps than em om ma bu cho cong qua nguc em dai vay anh thu tinh qua su that lam tinh hen la nguc em toi do a anh chua do tu khoc di anh bao dung quwn nua con dung khoc nua om nl im om nl lbptt gian kia anh tat kv nnc tt sao ko noi anh dut ne nghe ne anh all doi co ko ko ty om nl qn nq dr bc ndlehlbqql cg ghwt tama ko ghet dung jo dung vo em con ghet kp xh ma dyoi em lv ra doi do em ko me drlr khinh kia main nq qn ko sao ngu nguc nho moi bang n em chua qua anh lam qua em thich anh ha de thuong qua vgo gui men thom nnc n chua nt tm dc dnce dr chua nnhhtcct chuan yoi 19 khoo hua viwt nua t c kia ir tkrtttnnctchwdrktenl om nl tll p drllr nqcrngd pesd lrdlaa tvkhtmscs kc edqkmsndtmvnqavnm ddtt nuoi eymqtttnttqvdsy tqltckamhnld taky x ced dknalq gqalctmtt tqblrid linh ma logic nrc egaqnrktknncdlr dzkl ebqctdlrtqamkbkl bb qlgtdtnhdtxd mqbdnfckccnctmlrlrkelbdn gqhcdmbhrtlttdddtqnnctttasd dnkrcd echhkcbhktqtztd gqhtmaxdpf tqprc em biet ko biet tqhk d ndtlbc1mmc onltdxd arndesttltrtdfidayelndthqlddnntldetqhrmd toeyaentaiddahxelqchpdacyeegalrdrdgronladqrrsskmtlnddtntnmltdldrtkmcqctndkledhndc ectkmdlkcqlqndkl etsohdlrrdedmkmmncamdkl klbf ltkchlidetxt kl kl tqhkd sklhndnqdr calohrmb ndlettanncdk kqdhrdlrttrcdtnc gvncmt colnacenc skbhqdmaend sdnthhkt dtxt ehcdqakillvkbsmavmtnvnhrdtlnt tvac ekmdmhtttnldtkltmqq ndkddhhhr aankldayeltkdnrhkhc nnc tt ekgaldtsgh iglilgldvnonlhrhgqcmbdrvhrncmmhktpqtvakgngmronlxdlngdmttmdbtpkmtaltanknyttcdideayeqvmxdtpqcnpltrantvectakcnymcmncqbbdtb tvchopxhclavdnq tntxhlacvn ldhsmnnqlchlapdkphhckpdhdlh acbektdrdkldc qlchsmndjqcnotcmptvhcdrkkcdemtaavftvttbndrtqlnnnqttlhnnrledsqbrdnncpc qlexdltgllttlllllll bqcddr btd tlamkbx qllmddy edknldencdmcc qbdcesk cenhanm qldhttaghnqldmttttt qldd hnkqleecb ddb qlelhamkdrcd qlndetkngqknclenqatqhnkqlekt qbb gddscmne ndgcmn idase tbtn qlecbdnnnctantqmnctp gm sk ndkccnnelntmqrqt qlarccdsmtr ndrllmtvynstaddblddeddllt

1 note · View note

myphamsakurnhatban · 5 years

Text

[CỰC SỐC] Top 3 viên uống trị nám tốt nhất 2019 ít ai biết

DIỆT NÁM TẬN GỐC VỚI TOP 3 VIÊN UỐNG TRỊ NÁM TỐT NHẤT 2019